Team 6 Game Design Document ( ) Contents. Introduction...2. Mechanics...3. Health Bars..5. Altered Landscape System...5. Screens...6. Story..

Size: px
Start display at page:

Download "Team 6 Game Design Document ( ) Contents. Introduction...2. Mechanics...3. Health Bars..5. Altered Landscape System...5. Screens...6. Story.."

Transcription

1 1 Team6GameDesignDcument( ) Cntents Intrductin...2 HighCncept Objectives Stry Setup Mechanics...3 PlayerMechanics AIPlayerSpecificMechanics EnemyMechanics HealthBars..5 AlteredLandscapeSystem...5 Screens...6 MainMenu PauseMenu OptinsMenu LevelSelect/Achievements WinScreen/Achievements OtherScreens Stry..9

2 2 Overview GameIntrductin Instructins FutureDesignCncerns 11 Thughts ThingsIThinkCuldBeCut ThingsChanged/Cut Intrductin HighCncept: Creaturesfancientlegendhavemysteriuslyreemergedandaresuckingawaythetriballand swater supply.ahumanandaiplayertakentherleftribalshamanswhknwthatinrdertsavethe planet,theymustenticethesecreaturesintchasingthem,andtrickthemintcllidingtgether. Objectives: Playersenticeenemiesbyprximityintchasingthem. Frceenemiestcllideinteachtherttakebackearth sstlenwater. Setup: Twplayersinhabitamazewhichisfilledwithanevenamuntfenemies. Tp dwnperspective. Cameraisstatinaryandshwsentiremaze. 800x600.Allwfrfull screen/resizablescreen. Includeabrderarundthemazewhichis12pixelsthick. Ontherightsidefthescreenisa200pixelthickmarginswhichhldUIbjects. Objectsinthemazecanbeatmst64x64pixels.

3 3 Shws brder, UI, and bjects in maze. The art style is meant t resemble figures and stries n a scrll. Mechanics Player Mechanics: Idle: N buttns are pressed and the player stays in place. Mve: Human players can mve in 4 directins in realtime while the crrespnding buttns are pressed. Pressing a key walks a player frm ne grid space t anther. Players may nt walk thrugh walls but mvement in any ther directin is nt impeded by clliding with a wall. Take Damage: Players take damage while they are clliding with an enemy. Players d nt recver health when they crash enemies. Players stp taking damage when they mve away frm an enemy. Die: Players will die if their runs health ut. Actins Stay Keys (Default) n arrws are pressed Run in any Directin (1P) r in 1P mde

4 4 Run in any Directin (2P) Pause / G Back in menu navigatin Cnfirm / G Frward in menu navigatin r Navigate any menu r r (Muse cntrl) AIPlayerSpecificMechanics: AIPlayerusessameverbsetashumanplayer AIplayerdecides: Whethertmeetwithhumanplayerandattempttcllideenemies Wheretmeethumanplayersandhwtgetthere EnemyMechanics: Idle:Ifnplayerisavailabletchase,anenemywillstayinplace. Agitated:Whentheplayerfirstapprachesanenemy,itmakesagarglingnise,andmvesits tentaclesquicker. Chase:Afteraplayeragitatesanenemyandmvingawayfrmit,thatenemywillrelentlessly chasetheplayer.ifaplayeralreadyhasanenemychasinghim,theenemieswillfrmatailand chasetheplayer. DamagePlayer:Ifanenemycllideswiththeplayerit schasing,theenemytailwillstp mvingandwilldamagethatplayer.enemieswillresumechasingaplayerwhentheplayer beginstmveagain.

5 5 GetDestryed:Enemiesdestryeachtherata1:1ratiwhentheycllidewitheachther. Onlyenemieswharechasingtwdifferentplayerscandestryeachther. Splash:Afterenemiescllide,thewaterthey vestlensplashesut.ifmanyenemiescllidein rapidsuccessin,eachfllwingsplashislargerthanthelastandalargerareaisgreenified. HealthBars Lcatedntheleftsidefthescreen Healthsignificantlydecreaseswhentheplayeriscllidingwithanyenemy Playersstartthenextlevelwith100%health. Whenplayersdiethelevelrestartswithbthplayersat100%health Themeter seyedbecmesx swhenthecrrespndingplayerdies Thewaterbugsfillupasthehealthbarsdrain

6 6 AlteredLandscapeSystem Afterenemiescllide,thewaterthey vestlensplashesut.ifmanyenemiescllideinrapid successin,eachfllwingsplashislargerthanthelast.afterthewaterdisappearsthenearby landscapebecmesmreclrful/blssms. Onlytheareaarundthesplashzneisbeautified Enemies AreaAltered 1x1 3x3 5x5 7x7 9x9 Ifthesameareaisbeautifiedagainflwersareimplantedtmakethegreenerylkdenserinthatarea. Afterthelevelends,givetheplayerstimetappreciatethebeautifiedlandscape. Screens Allscreensexistnagiantscrll.Chsinganptinscrllsthescreen.

7 7 Scrlllayut. Mapstheflwfmenus Befreanptinisselected,thecharactersruninplace.Afteranptinisselected,theenemiescllide. MainMenu 1Plevels:Takestheplayertlevelsmeantfr1PandAI. 2Plevels:Takesplayerstlevelsmeantfr2humanplayers.

8 8 Optins: Takes players t ptins screen. Credits: Takes players t credits screen. Pause Menu When the game is paused, all actin n screen stps. A lt f the pause menu is dedicated t shwing instructins r pertinent infrmatin. There are als buttns t: Resume: Takes players back t game. Shuld als be dne by pressing escape (Esc) n keybard. Fr cnsistency, always put the Resume buttn in the bttm left crner. Optins: Takes players t ptins screen. Main Menu: Takes players t ptins screen. Optins Menu The ptins menu culd be the same size as the pause menu. Accessing this menu frm the main menu can nly bring the player back t the main menu when resume is pressed. Accessing this menu frm the pause menu can nly bring the play when resume is pressed. The ptins menu cntains: Resume: Takes players back t previus screen. Shuld als be dne by pressing escape (Esc) n keybard. Fr cnsistency, always put the Resume buttn in the bttm left crner. Music: Bar allwing music vlume t be adjusted. SFX: Bar allwing SFX vlume t be adjusted. Key Cnfiguratins: Allws players t chse frm pre chsen key cnfiguratins. On the left is the pause screen. On the right is the ptins menu. Stage Select Stages becme unlcked as players beat previus stages. If a level is unavailable an arrw which navigates t that level is grayed ut. Achievements are displayed fr each level. If an achievement is

9 9 unearned the achievement icn is displayed grayed ut. If an achievement was previusly earned the icn is clred. If an achievement is impssible, n icn is displayed. Win Screen If an achievement is earned during a rund f play, the icn and descriptin appear n the win screen. If an achievement is nt earned, the icn is nt displayed. Achievements are nly available in 2P mde. The achievements are: Tribe Savir: Cleared the stage f enemies. Water Guard: Finished with full health. Big Smash: Smashed every enemy at nce. On the left is the stage select screen. On the right is the win screen. Other Screens On the left is the lse screen. On the right is the win all screen.

10 10 On the left is the legal screen. On the right is the credits. Stry Overview: The legendary creatures frm the stries f the sacred ancestrs have returned t the tribal lands and are nce again threatening the land s water supply. As the earth grws dry and barn, the tribal land s mst revered shamans prepare t reclaim the wrld s water and drive these creatures ut f the tribal lands by perfrming the same ritual cmbat as the ancestrs. These creatures are very fierce and easily agitated. Only a shaman wh pssesses the highest blessings f the ancestrs may hpe t apprach these creatures. The unspeakable creatures frm the time f the ancestrs have returned t the Tribal Lands. They will drain the land f its water and bring famine t ur peple. All the Tribal Lands and its peple will becme dust shuld the tribes fail t fllw the instructins left by the ancestrs: Hierglyphic style artwrk n the main menu tells the stry.

11 11 Instructins: 1PIntrLevelInstructins: Textfrbttmpartflevel(fitsin576x192) Trigger Use(ARROWSpicture)tcntrlthe(P1picture)tribalshaman. Levelstarts RUN!The(enemypicture)creatureswillsuckthewaterutfyuifyustp! (arrwpintingleftthealthbars)payattentintyurhealthbars! Playermves Wrkwiththe(P2picture)tribalshamantsmashthe(enemypicture) tgetherandrestrethewatertthetriballands. (Animatinfcrashingtgether) Previustexthasbeen shwnfr3secnds, rbugshavebeen smashed,rplayer dies Press(Escpicture)tseeinstructinsagainradjustsettings. Previustexthasbeen shwnfr3secnds andbugsaresmashed 2PIntrLevelInstructins: Textfrtppartflevel(fitsin576x192) Trigger Use(ASDWpicture)tcntrlthe(P1picture)tribalshaman. Use(ARROWSpicture)tcntrlthe(P2picture)tribalshaman. Levelstarts Lurethe(enemypicture)watersuckingcreaturesbygettingclsetthem. Anyplayermves2 squares RUN!The(enemypicture)creatureswillsuckthewaterutfyuifyustp! (arrwpintingleftthealthbars)payattentintyurhealthbars! Oneplayerisbeing chased SmashthecreaturestgethertrestrethewaterttheTribalLands. (Animatinfcrashingtgether) Previustexthasbeen shwnfr3secnds, rbthplayersare beingchased Press(Escpicture)tseeinstructinsagainradjustsettings. Previustexthasbeen shwnfr3secnds andbugsaresmashed

12 12 FutureDesignCncerns Thughts: Levelsshuldbuilduptsmething. Ihatescres Ihatetimelimits WulditbeunfairtP2tlsethegamebecauseP1lseshishealth?Onepssibleslutin culdbethatwhenp1 shealthrunsutandhegetsdamages,healthbeginstdrainfrmp2 s metertwiceasfast.(reinfrcesbndrdualitybetweencharacters)thismightntbeneeded. ThingsIThinkCuldBeCut: Idn tknw.ineedtstartlkingfrthings ThingsChanged/Cut: ( )Frmattingfscreenchangedsthatmazebjectscanbesquare(64x64).GUIis nwnthesides. ( )Characterselectinscreencut. ( )Enemieswilldestryeachtheriftheyattempttjinapursuitatthesametime. ( )Addedpartabutmainmenuscrll. ( )FrtheLevel1Tutrialtwrkprperly,playersmuststartffwithlittlehealths thattheycan twalkpastthefirstpairfenemiestheyencunterandarefrcedtcrashthem tgether. ( )Playersalwaysstartwithfullhealth. ( )Achievementsadded

The WHO e-atlas of disaster risk for the European Region Instructions for use

The WHO e-atlas of disaster risk for the European Region Instructions for use The WHO e-atlas f disaster risk fr the Eurpean Regin Instructins fr use 1 Last Update: June 2011 Cntents 1. Basic system requirements... 3 2. Structure f the WHO e-atlas... 4 2.1. Main menu... 4 2.1.1.

More information

Microsoft PowerPoint 2007

Microsoft PowerPoint 2007 Micrsft PwerPint 2007 Finding Presentatins n the Web Open the Internet and g t http://www.ggle.cm Click n Advanced Search. Enter wrds r phrases t describe desired results. On the File Frmat line, click

More information

Excel Step by Step Instructions Creating Lists and Charts. Microsoft

Excel Step by Step Instructions Creating Lists and Charts. Microsoft Infrmatin Yu Can Enter in a Wrksheet: Labels: Any type f text r infrmatin nt used in any calculatins. Labels are used fr wrksheet headings and make wrksheets easy t read and understand. Labels can als

More information

Flash Image Rotator Web Part

Flash Image Rotator Web Part Flash Image Rtatr Web Part User Guide Cpyright 2007 Data Springs Inc. All rights reserved. Table f cntents: 1 INTRODUCTION...3 2 INSTALLATION PROCEDURE...4 2.1 After installatin ntes:...5 2.2 Trubleshting...6

More information

Support Subscribers call

Support Subscribers call Prduced by Cmputer Helper Publishing (CHP). We hpe this sftware makes the tasks f Church administratin easier and mre efficient. Any questins that cannt be answered by these help files shuld be directed

More information

AccuBuild Version 9.3 Release 05/11/2015. Document Management Speed Performance Improvements

AccuBuild Version 9.3 Release 05/11/2015. Document Management Speed Performance Improvements AccuBuild Versin 9.3 Release 05/11/2015 Dcument Management Speed Perfrmance Imprvements The entire dcument management system and security system design was retled which shuld result in majr speed imprvements

More information

Drawing Canvas Word 2007

Drawing Canvas Word 2007 Drawing Canvas Wrd 2007 This is nt an fficial training handut f the Educatinal Technlgy Center, Davis Schl District The Drawing Canvas... 2 Creating the Drawing Canvas... 2 Shapes... 2 Inserting a Shape...

More information

Table of Contents. ilab Solutions: Core Facilities Core Usage Reporting

Table of Contents. ilab Solutions: Core Facilities Core Usage Reporting Revisin Date: 12/31/2012 Table f Cntents 1. Institutin, Cre Facility and Lab Administratin Reprting Overview...2 2. Hw d I access ilab Reprts?...3 3. What is the General Functinality fr ilab Reprting?...6

More information

Using the Laser Cutter

Using the Laser Cutter Using the Laser Cutter Prerequisites Befre yu will be allwed t use the laser cutter, yu must cmplete these three steps: 1. Yu must have cmpleted the Laser Cutter training at Cyberia 2. Yu must schedule

More information

CUSTOMER PORTAL. Floorplan Management

CUSTOMER PORTAL. Floorplan Management CUSTOMER PORTAL Flrplan Management FLOORPLAN ANALYTICS The flrplan analytics area displays flrplans yu have uplad t the prtal (if yu haven t yet upladed a flrplan please cntact ur supprt department). Frm

More information

NanoDrop One/One C Printing

NanoDrop One/One C Printing MARK S100 INSTRUCTIONS NanDrp One/One C NanDrp One/One C Printing Fr use with versin 1.4 f lcal cntrl sftware All Therm Scientific NanDrp One/One C instruments with versin 1.4 f lcal cntrl sftware can

More information

Photoshop Elements 7 Intermediate: Layout & Design

Photoshop Elements 7 Intermediate: Layout & Design Phtshp Elements 7 Intermediate: Layut & Design Designing a prject... 2 Preparing pictures fr use in a prject... 2 Creating a new blank dcument... 2 Adding a picture(s) t a prject... 2 Turning n the Ruler/Grid...

More information

Documentation of the PIC32 Pin Finder

Documentation of the PIC32 Pin Finder App. Versin: 1.1.1.120 Dcument Versin: 1.0 Dcument Create date: 2009-10-16 Dcument Update: 2009-10-19 22:37 Authr: B Gärdmark Cmpany: Spectrn System Develpment AB WEB: www.spectrn.us Cpyright 2009 All

More information

Wonder Tree Video Slot Introduction. How to Bet. Gamble Feature

Wonder Tree Video Slot Introduction. How to Bet. Gamble Feature Wnder Tree Vide Slt Intrductin Wnder Tree vide slt is a 5-reel, 20-line game. The slt cnsists f 11 cards - 1 f which is Wild, and 1 is Scatter. All winning cmbinatins are paid left t right, except fr the

More information

PowerCADDTM 5/10/2018. Drawing by James Fleming and Matt Arnold

PowerCADDTM 5/10/2018. Drawing by James Fleming and Matt Arnold PwerCADDTM Tutrial 5/10/2018 Drawing by James Fleming and Matt Arnld Hw t Read This Dcument This manual is an interactive PDF that acts in sme ways like a bk and als like a prgram, with links that will

More information

Set up and use your Beats X earphones

Set up and use your Beats X earphones Set up and use yur Beats X earphnes Here's everything yu need t knw t make the mst f yur Beats X earphnes. Turn n The pwer buttn is n the cable beneath the right earphne. Press and hld the buttn fr 1 secnd

More information

Standard Operating Procedure for SEM3 (ThermoFisher / FEI Apreo)

Standard Operating Procedure for SEM3 (ThermoFisher / FEI Apreo) Standard Operating Prcedure fr SEM3 (ThermFisher / FEI Apre) Befre beginning, ensure yu have an active reservatin fr SEM3 in CreResearch@Duke Lading a Sample: If Sample Exchange Windw is nt pen, click

More information

DEAD MAN S DOUBLOONS. Rules v1.2

DEAD MAN S DOUBLOONS. Rules v1.2 DEAD MAN S DOUBLOONS Rules v1.2 OVERVIEW Welcme t Dead Man s Dublns, an actin packed bard game fr 2 t 6 players, playable in 30 t 45 minutes. Each player takes n the rle f a legendary pirate ship captain,

More information

SunGuide TM GUI Design Review Release 3.1 Express Lanes Meeting Minutes Date: March 10, 2008 Location: Video Conference

SunGuide TM GUI Design Review Release 3.1 Express Lanes Meeting Minutes Date: March 10, 2008 Location: Video Conference SunGuide TM GUI Design Review Release 3.1 Express Lanes Meeting Minutes Date: Lcatin: Vide Cnference Attendees: Trey Tillander, FDOT CO Steve Crbin, FDOT D4 Rry Santana, FDOT D6 Manny Fntan, FDOT D6 David

More information

Frequency Response of a BJT CE Amplifier

Frequency Response of a BJT CE Amplifier Frequency Respnse f a BJT CE Amplifier Run the experiment By clicking the arrw n the Tlbar. Chse values f C B & C C, C E & R C frm the crrespnding drp dwn menus. (Clicking the arrw n the right side f the

More information

PLIC Books School User s Manual

PLIC Books School User s Manual Schl User s Manual is a web based yearbk sftware that lets users, studi r schl, lgin and wrk n their yearbks frm anywhere. is very user friendly and allws users t uplad their wn graphics and images t easily

More information

Freading for Kindle Fire Using the SlideME app.

Freading for Kindle Fire Using the SlideME app. Harvard Public Library www.harvardpubliclibrary.rg Freading fr Kindle Fire Using the SlideME app. Freading is an e-bk cllectin, available t Harvard Public Library cardhlders, that ffers tens f thusands

More information

Last update: December 26, English Translation DRAFTS of Asian Rules by Eric Wu. Contents

Last update: December 26, English Translation DRAFTS of Asian Rules by Eric Wu. Contents WXF r Asia rule Name:Lee JiHai (The Cmmittee f Referees Hng Kng Chinese Chess Assciatin) Lcatin:Hng Kng Last update: December 26, 2005 English Translatin DRAFTS f Asian Rules by Eric Wu. Cntents Intrductin

More information

User Guide. ACC Mobile 3 Preview App for Android

User Guide. ACC Mobile 3 Preview App for Android User Guide ACC Mbile 3 Preview App fr Andrid 2017-2018, Avigiln Crpratin. All rights reserved. AVIGILON, the AVIGILON lg, AVIGILON CONTROL CENTER, ACC, and TRUSTED SECURITY SOLUTIONS are trademarks f Avigiln

More information

Dice High Video Slot. Introduction. How to Bet. Gamble Feature

Dice High Video Slot. Introduction. How to Bet. Gamble Feature Dice High Vide Slt Intrductin Hw t Bet Gamble Feature Game Cntrls Rules Dice Feature Jackpt Cards Bnus Game Interruptins Return t Player Intrductin Dice High vide slt is a 5-reel, 20-line fixed game. The

More information

Photoshop Elements: Color and Tonal Correction Basics

Photoshop Elements: Color and Tonal Correction Basics Phtshp Elements: Clr and Tnal Crrectin Basics Cntrast Lighten Phtshp Elements: Clr and Tnal Crrectin Basics 1 Sharpen Expsure Phtshp Elements: Clr and Tnal Crrectin Basics 2 Highlights and Shadws All key

More information

User Guide. ACC Mobile 3 Preview App for ios

User Guide. ACC Mobile 3 Preview App for ios User Guide ACC Mbile 3 Preview App fr ios 2017, Avigiln Crpratin. All rights reserved. AVIGILON, the AVIGILON lg, AVIGILON CONTROL CENTER, ACC, and TRUSTED SECURITY SOLUTIONS are trademarks f Avigiln Crpratin.

More information

KIP Cost Center User Guide

KIP Cost Center User Guide - 1 - KIP Cst Center User Guide Cntents 1 Intrductin... 3 1.1 Requirements:... 4 1.2 Supprted Operating Systems... 4 2 Installatin... 5 3 Setup... 8 4 KIP Cst Center Main Screen Print Mde... 12 4.1 Lading

More information

High Level Design Circuit CitEE. Irere Kwihangana Lauren Mahle Jaclyn Nord

High Level Design Circuit CitEE. Irere Kwihangana Lauren Mahle Jaclyn Nord High Level Design Circuit CitEE Irere Kwihangana Lauren Mahle Jaclyn Nrd 12/16/2013 Table f Cntents 1 Intrductin. 3 2 Prblem Statement and Prpsed Slutin. 3 3 Requirements. 3 4 System Blck Diagram 4.1 Overall

More information

100 Super Hot Video Slot Introduction. How to Bet. Gamble Feature

100 Super Hot Video Slot Introduction. How to Bet. Gamble Feature 100 Super Ht Vide Slt Intrductin 100 Super Ht vide slt is a 5-reel, 100-line fixed game. The slt cnsists f 8 cards - 1 f which is Wild, and 1 is Scatter. All winning cmbinatins are paid left t right, except

More information

Desktop Teller Exception User Guide

Desktop Teller Exception User Guide Desktp Teller Exceptin User Guide Jammed Dcuments If a dcument jams during the scanning prcess, the scanner will stp, and a message bx will display a Device Errr Message, as shwn belw: Click OK t allw

More information

Manual Zeiss Axio Zoom.V16 microscope and ZEN 2 Pro software

Manual Zeiss Axio Zoom.V16 microscope and ZEN 2 Pro software Manual Zeiss Axi Zm.V16 micrscpe and ZEN 2 Pr sftware 15-9-2015 Fred Hartjes EMS 3 Caxial illum. Ring illum. Starting up Pwer n Actuate the knb n the EMS 3 cntrl unit Switch n the caxial illuminatin Switch

More information

Using the Register of Swiss Surnames

Using the Register of Swiss Surnames Using the Register f Swiss Surnames Switzerland Hw t Guide, Beginning Level: Instructin Octber 2015 GOAL This guide will teach yu t navigate the nline versin f the Register f Swiss Surnames, and hw t utilize

More information

Meal Time! Game Concept

Meal Time! Game Concept Meal Time! Game Cncept Lucien LeMenager Kevin Mann Rbert Dyle Wrking Title Meal Time! Prject Thumbnail A game based n turn- based trading card games, Meal Time! pits players against each ther t crwn the

More information

Razor Tracking: User Guide

Razor Tracking: User Guide Cntents 1. Setup Instructins...3 1.1 Administratin...3 GPS Device Inf...3 Peple Management...4 Vehicle Setup (Fleet and Asset Devices)...5 Vehicle Grup Setup...7 Departments...7 Camera Management...8 Public

More information

1.12 Equipment Manager

1.12 Equipment Manager Mdule 1 Categry 1 1.12 Equipment Manager Functin f the windw The windw is the central data file fr the Kntrl Pr and cllects the main data fr fees f an bject that t be used in this prject. The Equipment

More information

RZ251W. Remote Sensing & Zoning Installation Guide. Quick Reference. Wireless Range

RZ251W. Remote Sensing & Zoning Installation Guide. Quick Reference. Wireless Range Remte Sensing & Zning Installatin Guide Pr Technlgies P.O. Bx 3377 Springfield, MO 65804 Tll ree : 888-776-47 Web: www.priaq.cm Hurs f Operatin: M- 9AM - 6PM Eastern Table f Cntents Table f Cntents Quick

More information

Version Switch resolutions When checked, Myth will switch the monitor resolution when showing the Myth main menu and when entering a game.

Version Switch resolutions When checked, Myth will switch the monitor resolution when showing the Myth main menu and when entering a game. Versin 1.8.0 1. Preferences 1.1 Startup Screen (Mac nly) These ptins appear in a small separate windw fr Mac users when Myth starts up. If it is set t n lnger shw this dialg, just hld Optin key when launching

More information

Security Exercise 12

Security Exercise 12 Security Exercise 12 Asynchrnus Serial Digital Baseband Transmissin Discussin: In this chapter, yu learned that bits are transmitted ver a cpper wire as a series f vltage pulses (a prcess referred t as

More information

Remote Control Learn Button Receiver Input Connections

Remote Control Learn Button Receiver Input Connections Remte Cntrl Learn Buttn Receiver Input Cnnectins Remte Cntrl LED Light Wi-fi/Factry Reset Buttn Receiver Output Cnnectin Heartbeat LED Light PRV Cnnectins Pwer Reset Buttn Pl / Treadmill Switch Flat Switch

More information

Colourful Stitches. Quick Summer Medallion. 45 x 45 Gyleen X. Fitzgerald Quick Summer Medallion.

Colourful Stitches. Quick Summer Medallion. 45 x 45 Gyleen X. Fitzgerald   Quick Summer Medallion. Quick Summer Medallin 45 x 45 Clurful Stitches 16 (finished) panel r rphan blck fr center ½ yard, center framing triangles ¼ yard, skinny frame brder 1 ⅔ yard, inside setting triangles 1¼ yard, utside

More information

INSTALLATION INSTRUCTIONS

INSTALLATION INSTRUCTIONS Lad: Min. 5 kg Max. 100 kg TS1000A TS700A INSTALLATION INSTRUCTIONS CONTENT: 1. Imprtant safety instructins. 2. Specificatins and main measures. 3. Parts included. 4. Installatin. 5. Adjusting the strke

More information

The objective of Man of Steel is to obtain winning symbol combinations by spinning the reels.

The objective of Man of Steel is to obtain winning symbol combinations by spinning the reels. Man f Steel 5-Reel 25-Line Slt The bjective f Man f Steel is t btain winning symbl cmbinatins by spinning the reels. TO PLAY THE GAME The Man f Steel game can be played in bth landscape and prtrait mdes.

More information

APPLICATION NOTE Sales & Application DEWESoft Slovenia

APPLICATION NOTE Sales & Application DEWESoft Slovenia Sales & Applicatin DEWESft Slvenia Abstract: This applicatin nte shws a measurement with DEWESft sund pwer measurement system and GRAS 67HA Hemisphere. The bject under test was a standard ntebk, the measurement

More information

You Be The Chemist Challenge Official Competition Format

You Be The Chemist Challenge Official Competition Format 2018-2019 Yu Be The Chemist Challenge Official Cmpetitin Frmat This dcument prvides detailed infrmatin regarding the Challenge frmat at each level f the cmpetitin. Schl Crdinatrs, participants, and parents/guardians

More information

GAMIFICATION REFERENCE GUIDE

GAMIFICATION REFERENCE GUIDE GAMIFICATION REFERENCE GUIDE 2 TERMINOLOGY Game Gal: What the bjective f the game is/ hw t win the game. The Game gal des nt equal the learning gal Ex: In Mnply, the gal f the game is t have the mst prperty

More information

CAR ASYST - Quick Start Guide MAIN MENU

CAR ASYST - Quick Start Guide MAIN MENU fficially apprved by CAR ASYST - Quick Start Guide MAIN MENU Main menu The main menu f ur CAR ASYST APP is divided int 7 menu items. Belw yu will find a list f these items including a shrt descriptin.

More information

GENERAL RULES FOR ALL MALIFAUX TOURNAMENTS MALIFAUX TEAM TOURNAMENT (50 STONES)

GENERAL RULES FOR ALL MALIFAUX TOURNAMENTS MALIFAUX TEAM TOURNAMENT (50 STONES) GENERAL RULES FOR ALL MALIFAUX TOURNAMENTS All Turnaments will be run using the Malifaux Gaining Grund 2011 rules. Exceptins and special rules are listed belw: All Mdels must be fully painted (3 clr standard)

More information

DXF2DAT 3.0 Professional Designed Computing Systems 848 W. Borton Road Essexville, Michigan 48732

DXF2DAT 3.0 Professional Designed Computing Systems 848 W. Borton Road Essexville, Michigan 48732 Prgram Infrmatin 1 DXF2DAT 3.0 Prfessinal Designed Cmputing Systems 848 W. Brtn Rad Essexville, Michigan 48732 Cntact: (989) 892-4376 website: http://www.famwrk.net General Infrmatin: inf@famwrk.net Technical

More information

Fourier Series LABVIEW GUI Documentation

Fourier Series LABVIEW GUI Documentation Furier Series LABVIEW GUI Dcumentatin INTRODUCTION The Furier Series GUI is meant t be used as a learning tl t better understand the Furier Series. The user is able t input the amplitude and frequency

More information

Altis Flight Manager. PC application for AerobTec devices. AerobTec Altis v3 User Manual 1

Altis Flight Manager. PC application for AerobTec devices. AerobTec Altis v3 User Manual 1 Altis Flight Manager PC applicatin fr AerbTec devices AerbTec Altis v3 User Manual 1 Table f Cntents Intrductin...3 Requirements...3 Installatin...3 Applicatin...3 USB Driver fr Altis v3 interface ALink...4.NET

More information

POWERSLED CIRCUIT INTRODUCTION GAME COMPONENTS

POWERSLED CIRCUIT INTRODUCTION GAME COMPONENTS POWERSLED CIRCUIT WRITTEN & DESIGNED BY Kevin Smith GRAPHIC DESIGN & EDITING Daniel Kast Eric Rennie PLAYTESTING Tm Akerman Rbert Flaharty Keith Hudsn Chris McArthur Glenn Mchn Demian Rse Tm Warhurst Cpyright

More information

Mobile LightSync Link App Programing Guide Revision 2

Mobile LightSync Link App Programing Guide Revision 2 Mbile LightSync Link App Prgraming Guide Revisin 2 Overview: The Mbile LightSync Link App emulates LightSync input devices used t cntrl ILC relays and dimmer utputs frm an Andrid r Apple mbile device.

More information

My Little Pony CCG Comprehensive Rules

My Little Pony CCG Comprehensive Rules My Little Pny CCG Cmprehensive Rules Table f Cntents 1. Fundamentals 101. Deckbuilding 102. Starting a Game 103. Winning and Lsing 104. Cntradictins 105. Numeric Values 106. Players 2. Parts f a Card 201.

More information

PAPER SPACE AND LAYOUTS

PAPER SPACE AND LAYOUTS PAPER SPACE AND LAYOUTS There are tw distinct wrking envirnments in AutCAD namely: Mdel Space and Paper space. Prjects can be develped by either wrking in the mdel space thrugh the use f MVSETUP r PAPER

More information

Upgrading to PlanetPress Suite Version 5

Upgrading to PlanetPress Suite Version 5 Upgrading t PlanetPress Suite Versin 5 Creatin date: September 2, 2005 Revisin date: June 14, 2006 Table f Cntents System Requirements... 4 Imprtant Cnsideratins... 4 Knwn Issues... 6 Prcedure t imprt

More information

VIP-200. Point to Point Extension Configuration Quick Start Guide. Video over IP Extender and Matrix System

VIP-200. Point to Point Extension Configuration Quick Start Guide. Video over IP Extender and Matrix System VIP-200 Vide ver IP Extender and Matrix System Pint t Pint Extensin Cnfiguratin Quick Start Guide PureLink TM 535 East Crescent Avenue Ramsey, NJ 07446 USA Cntents What is in the bx... 3 Transmitter kit

More information

Formative Evaluation of GeeGuides: Educational Technology to Enhance Art Exploration

Formative Evaluation of GeeGuides: Educational Technology to Enhance Art Exploration Frmative Evaluatin f GeeGuides: Educatinal Technlgy t Enhance Art Explratin Prepared by Clleen F. Manning Senir Research Assciate Gdman Research Grup, Inc. Submitted t GeeGuides LLC March 2005 EXECUTIVE

More information

INSTALLATION INSTRUCTIONS

INSTALLATION INSTRUCTIONS Lad with min. 5 kg 405000090 405070090 INSTALLATION INSTRUCTIONS CONTENT: 1. Imprtant safety instructins. 2. Specificatins and main dimensins. 3. Parts included. 4. Installatin. 5. Adjusting the strke

More information

Batman & The Penguin Prize

Batman & The Penguin Prize Batman & The Penguin Prize The bjective f Batman & The Penguin Prize is t btain winning symbl cmbinatins by spinning the reels. TO PLAY THE GAME The Batman & The Penguin Prize game can be played in bth

More information

BV4115. RF Packet Transmitter. Product specification. February ByVac 2007 ByVac Page 1 of 5

BV4115. RF Packet Transmitter. Product specification. February ByVac 2007 ByVac Page 1 of 5 Prduct Specificatin Prduct specificatin. February 2007 ByVac 2007 ByVac Page 1 f 5 Prduct Specificatin Cntents 1. Dcument Versins... 2 2. Intrductin... 2 3. Features... 2 4. Battery Life... 2 5. Blck Diagram...

More information

Maxon Motor & Motor Controller Manual

Maxon Motor & Motor Controller Manual Maxn Mtr & Mtr Cntrller Manual Nte: This manual is nly fr use fr the Maxn mtr and cntrller utlined belw. This infrmatin is based upn the tutrial vides fund nline and thrugh testing. NOTE: Maximum Permitted

More information

SARMAP RELEASE NOTES. Version: 7.0 (July 2016) rpsgroup.com

SARMAP RELEASE NOTES. Version: 7.0 (July 2016) rpsgroup.com SARMAP RELEASE NOTES Versin: 7.0 (July 2016) 55 Village Square Dr. Suth Kingstwn, RI 02879 Tel: (401) 789-6224 Fax: (401) 789-1932 Email: MapSupprt@ Table f Cntents Table f Cntents...ii 1 Intrductin...

More information

Dry Contact Sensor DCS15 User Manual

Dry Contact Sensor DCS15 User Manual Dry Cntact Sensr DCS15 User Manual Help Versin updated till firmware 404i / SP456 Cpyright 2012, AKCess Pr C., Ltd.. Intrductin / What is a Dry Cntact Sensr The Dry Cntact sensr r DCS15 is a simple cnnectin

More information

TUTORIAL I ECE 555 CADENCE SCHEMATIC SIMULATION USING SPECTRE

TUTORIAL I ECE 555 CADENCE SCHEMATIC SIMULATION USING SPECTRE TUTORIAL I ECE 555 CADENCE SCHEMATIC SIMULATION USING SPECTRE Cadence Virtus Schematic editing prvides a design envirnment cmprising tls t create schematics, symbls and run simulatins. This tutrial will

More information

SISTEMA ELEVATÓRIO ETV 460A

SISTEMA ELEVATÓRIO ETV 460A Parts included with yur Flat Lift Lift unit ( #1 ) Pwer supply ( #2 ) R.F. Mdule ( #3 ) Rcker switch ( #4 ) Remte Cntrl ( #5 ) Lift unit ( #1 ) Remte Cntrl ( #5 ) Pwer supply ( #2 ) Rcker switch ( #4 )

More information

TGI Toss N Teach Help

TGI Toss N Teach Help Enabling PwerPint Macrs: TGI Tss N Teach Help This game cntains VBA macr cding, which allws it t d s many neat things. Yu MUST ENABLE macrs in PwerPint t perate the game. Open yur versin f PwerPint and

More information

Figure 1: A Battleship game by Pogo

Figure 1: A Battleship game by Pogo CSCI 2312-002: Object Oriented Prgramming Final Prject Assigned: Octber 17, 2017 Design Due: Octber 24, 2017 IN CLASS (Graded as ne hmewrk grade) Final prject Due: Nvember 16, 2017 at 11:59 PM Fr many

More information

Dispatcher Control for MotoTRBO Capacity Plus Systems

Dispatcher Control for MotoTRBO Capacity Plus Systems Dispatcher Cntrl fr MtTRBO Capacity Plus Systems This tutrial prvides brief instructins t set up the dispatch cntrl ver MtTRBO Capacity Plus systems, using SmartPTT dispatch sftware. Bth cases are cnsidered:

More information

Configure and Use Bar Tabs

Configure and Use Bar Tabs One Blue Hill Plaza, 16th Flr, PO Bx 1546 Pearl River, NY 10965 1-800-PC-AMERICA, 1-800-722-6374 (Vice) 845-920-0800 (Fax) 845-920-0880 Cnfigure and Use Bar Tabs In rder fr Bar Tabs t wrk a Credit Card

More information

Interaction System from The Lab

Interaction System from The Lab Interactin System frm The Lab The Interactin System is a series f scripts, prefabs and ther assets that were the basis f all the minigames and ther scenes in The Lab. The system was designed specifically

More information

3: Community Gathering Space

3: Community Gathering Space 3: Cmmunity Gathering Space What: 2 part spatial sequence with gathering area fr varius sized grups Entry Zne Prvide an intrductin t the area by establishing a md and character and as well as separating

More information

ANTIOCH UNIVERSITY VIRTIUAL WRITING CENTER

ANTIOCH UNIVERSITY VIRTIUAL WRITING CENTER IDENTIFYING AUDIENCE AND PURPOSE As yu mve further int yur research, it can be helpful t step back and name the purpse and audience yu think yur writing will serve. The prcess belw will help yu sift thrugh

More information

INSTALLATION INSTRUCTIONS

INSTALLATION INSTRUCTIONS Lad: Min. 5 kg Max. 100 kg TS1000A TS700A INSTALLATION INSTRUCTIONS CONTENT: 1. Imprtant safety instructins. 2. Specificatins and main measures. 3. Parts included. 4. Installatin. 5. Adjusting the strke

More information

SEARCHING PROVINCIAL NETLAW

SEARCHING PROVINCIAL NETLAW SEARCHING PROVINCIAL NETLAW Prvincial NetLaw ffers access t all Acts, Ordinances and Regulatins currently in frce and applicable t all 9 prvinces frm 1910 t date. Each amendment t an Act, Ordinance r Regulatin

More information

Operating Instructions

Operating Instructions TC 60/8 THERMOCOMPUTER TC 60/8 temp / time s s temp / time k start stp Operating Instructins Cntents General Infrmatin...1 Security Advice...1 Firing Curves...1 Typical Firing Curves...2 Entering a Firing

More information

Rift Navigation. Using the Rift. Take a tour of the features of the Rift. Here are the basics of getting around in Rift.

Rift Navigation. Using the Rift. Take a tour of the features of the Rift. Here are the basics of getting around in Rift. Using the Rift Take a tur f the features f the Rift. Rift Navigatin Here are the basics f getting arund in Rift. Whenever yu put n yur Rift headset, yu're entering VR (virtual reality). Hw t get arund

More information

Finding your Fantasy: Once Upon a Time... Student Teacher: Andrea Slusarski Co-op Teachers: Darci Wilson (3 rd ) Kelly Vail (2 nd )

Finding your Fantasy: Once Upon a Time... Student Teacher: Andrea Slusarski Co-op Teachers: Darci Wilson (3 rd ) Kelly Vail (2 nd ) Finding yur Fantasy: Once Upn a Time... Student Teacher: Andrea Slusarski C-p Teachers: Darci Wilsn (3 rd ) Kelly Vail (2 nd ) Grade Level: 2 nd & 3 rd Grade Date Taught: April 13 th, 2010 Date Revised:

More information

Spectracom GSG ecall Test Suite

Spectracom GSG ecall Test Suite 18-Dec-2017 GSG App Nte Spectracm GSG ecall Test Suite Table f Cntents 1. Intrductin... 1 2. Befre Starting the Test... 2 3. Running the ecall Test Suite... 4 4. Psitin Errr Tests 2.2.2-2.2.4... 10 5.

More information

TC 60 THERMOCOMPUTER TC 60. prog. start stop. Operating Instructions

TC 60 THERMOCOMPUTER TC 60. prog. start stop. Operating Instructions TC 60 prg start stp THERMOCOMPUTER TC 60 h C/h C Operating Instructins Cntents General Infrmatin...1 Security Advice...1 Firing Curves...1 Typical Firing Curves...2 Entering a Firing Curve...2 Checing

More information

JANUARY 1, garageband.doc REVISION 2. A hackrspace Documentation. BUSCH CAMPUS: HILL CENTER 254

JANUARY 1, garageband.doc REVISION 2. A hackrspace Documentation. BUSCH CAMPUS: HILL CENTER 254 JANUARY 1, 2014 garageband.dc REVISION 2 A hackrspace Dcumentatin. BUSCH CAMPUS: HILL CENTER 254 GarageBand Dcumentatin Page 1 Table f Cntents Remember! This is a guide that s nt fully develped! If yu

More information

Introduction to Life Cycle Risk Management Help Page

Introduction to Life Cycle Risk Management Help Page Select a frequently asked questin (FAQ) t skip t its answer. Hw is the curse rganized? Wh shuld take this curse? Hw d I get credit fr this curse? What d all the navigatin buttns d? Hw d I knw what t click?

More information

Name: Date: Period: 1. Multi-Genre Character Project

Name: Date: Period: 1. Multi-Genre Character Project Name: Date: Perid: 1 Multi-Genre Character Prject A multi-genre prject is ne large prject with many different parts. Each part represents what yu knw abut a tpic and extends yur thinking in many ways.

More information

INSTRUCTION BOOKLET (PUZZLES BY NIKOLA ZIVANOVIC)

INSTRUCTION BOOKLET (PUZZLES BY NIKOLA ZIVANOVIC) LMI DECEMBER PUZZLE TEST PUZZLES & CHESS -2. DECEMBER 200. INSTRUCTION BOOKLET (PUZZLES BY NIKOLA ZIVANOVIC) SUBMISSION: http://lgicmastersindia.cm/m2002p 0 PUZZLES 70 MINUTES POINTS TABLE CHESS BATTLESHIPS

More information

E-Jobsheet Tablet Application Functionality

E-Jobsheet Tablet Application Functionality E-Jbsheet Tablet Applicatin Functinality The e-jbsheet applicatin has been created fr Truck Service Prviders (TSP) in rder fr their admin staff and fitters t handle all types f wrk via a mbile platfrm

More information

Owner s Manual. English. Model 5 MINUTE. Form# Hunter Fan Co. 7 Day Programmable M T W T F S S

Owner s Manual. English. Model 5 MINUTE. Form# Hunter Fan Co. 7 Day Programmable M T W T F S S Owner s Manual English 5 MINUTE I N S T A L L A T I O N Mdel 44905 7 Day Prgrammable M T W T F S S Frm# 44050-01 20100603 2010 Hunter Fan C. Table Of Cntents At A Glance Knw Yur Thermstat............................................................

More information

Copyright 1994 by WellSpring International Educational Foundation. Reprinted with permission

Copyright 1994 by WellSpring International Educational Foundation. Reprinted with permission Cpyright 1994 by WellSpring Internatinal Educatinal Fundatin. Reprinted with permissin Claiming & Develping All Yur Gifts Identity Character Chice Relatinships Meaning Knwledge Grwth Spirituality Is Yur

More information

The UNIVERSITY of NORTH CAROLINA at CHAPEL HILL

The UNIVERSITY of NORTH CAROLINA at CHAPEL HILL Yu will learn the fllwing in this lab: The UNIVERSITY f NORTH CAROLINA at CHAPEL HILL Cmp 541 Digital Lgic and Cmputer Design Prf. Mntek Singh Fall 2016 Lab Prject (PART A): Attaching a Display t the Prcessr

More information

ColorCheck Reference Guide Onyx Graphics Inc. May 2018

ColorCheck Reference Guide Onyx Graphics Inc. May 2018 ClrCheck Reference Guide Onyx Graphics Inc. ClrCheck prvides an integrated tl set within Onyx Rip-Queue fr evaluating varius aspects f printing. With these tls in place a printer peratr can easily assess

More information

Original Recipe. Original Recipe can be found at

Original Recipe. Original Recipe can be found at Original Recipe Have yu ever gtten an idea in yur head and then had a hard time shaking it? It is like a sng that inserts itself int yur day and will nt be abandned. N matter what yu d that silly sng is

More information

Appendix D. Photography

Appendix D. Photography Appendix D Phtgraphy 1 I. Taking Phtgraphs Taking phtgraphs is a required NWCA field activity that prvides an imprtant visual recrd f sampling activities at each site. Phtgraphs are taken with a digital

More information

Introduction. Version 8.2.2

Introduction. Version 8.2.2 Intrductin As with each new versin, minr changes and new ptins are added. Sme f these changes are nt visible because they are designed t imprve functins and crrect sme minr bug. Fr visible changes, please

More information

60min Tinkerb t games

60min Tinkerb t games 60min + - Tinkerb t games Creepstne Manr has been clsed fr nearly ne hundred years, standing dark and silent abve the twn f Creepstne and that s just the way resident ghst Spkie likes it! But nw the manr

More information

C9 Trader Service User Guide

C9 Trader Service User Guide C9 Trader Service User Guide JUNE 2017 Cntents 1. Launching the C9 Trader... 2 2. Lgging in t Clud9... 2 3. Clud9 Hme Screen... 3 3.1 Cntrl Panel... 3 3.1.1 Hme Buttn... 3 3.1.2 Cmmunity Buttn... 3 3.1.3

More information

MiLAB. Version. User Manual. Copyright 2016 Fourier Education

MiLAB. Version. User Manual. Copyright 2016 Fourier Education MiLAB Versin User Manual Cpyright 2016 Furier Educatin Table f Cntents Intrductin... 4 Installing the Sftware n an ios device... 4 Installing the Sftware n an Andrid device... 4 Multilingual MiLAB... 5

More information

Ultracom for Apple ios (2.X.X >) Printable user manual

Ultracom for Apple ios (2.X.X >) Printable user manual 30.8.2018 Ultracm fr Apple ios (2.X.X >) Printable user manual Table f cntents 1. General... 3 1.1 General inf... 3 1.2 Ultracm subscriptin and additinal services... 3 1.3 Operatr settings... 3 1.4 General

More information

Expression Mixer User Manual , RiverSoftArt

Expression Mixer User Manual , RiverSoftArt User Manual Expressin Mixer User Manual 2017-2018, RiverSftArt Cntents Intrductin... 1 Features... 1 Expressin Mixer... 4 Buttns and Optins... 6 Intrductin Getting the exact perfect expressin can be a

More information

Snowball Fight. Components:

Snowball Fight. Components: Snwball Fight Snwball Fight is a micr deckbuilding and deductin game fr tw players that nly cntains 18 cards (a 3+ player variant is pssible with additinal decks see the end f the rules). In the game players

More information

Game Details. Ubisoft Toronto NEXT: User Interface Competition

Game Details. Ubisoft Toronto NEXT: User Interface Competition Ubisft Trnt NEXT: User Interface Cmpetitin The Brief Participants must prvide a package f mckups based n the game details and design brief prvided belw. The gal f this package is t pitch a UI Style Guide

More information

From Beginner to Expert in 90 Minutes

From Beginner to Expert in 90 Minutes Cmma CMMS Maintenance Management at Yur Fingertips Frm Beginner t Expert in 90 Minutes http://cmmacmms.cm Table f Cntents Intrductin... 3 Frm beginner t expert in 90 minutes... 3 Sessin 1 Set it Up! (5

More information