-SPECTATOR. Visit Oakton. * Oakton ",( Community College NILES MEET BEN FRANKLIN. fld sin. j.sra,jer -r ax. o:$-v.j9 ii: s:-ut(

NLES SPECTTOR PRL 30 2009 * PONEER PRESS PUBLCTON * WWWPONEERLOCLCOM * $200 DJERSONS THS WEEK RGNG N THE TUB :"XMen Origin: Wólverine" i featured in Film Clip SEE PGE B2 FOOD ND THEYRE OFF! Lcal tattle but burbnpiked Derby fare SEE PZONEERLOCLCOM a MEET BEN FRNKLN ctr Terry Lynch frm left mingle with Nue Hitrical Sciety Preident Marge Bene and member Nrbert Jhnn and Glria ndern in Nue n pril 26 Lynch pke with the grup in character a Benjamin Franklin PGE 6 (Shauna Bittle/Fr STNG) :$J9 ii: :Ut( j_ Ni)O M 0969 Lra jj1 ;31J:H jra jer r ax tx1 9tzcLQ1 FfL1CO O fld N 1Z71*U** iit Oaktn Cme and dicver why Oaktn i the ideal place t begin r cntinue yur cllege educatin Tueday May 5 at 4 pm Rm 1506 De Plaine Campu * Oaktn " ( Cmmunity Cllege Rccrvc yur cat at wwwakinedu 1600 Eat GifRad De Plaine F

2 wwwpineertcalcm THURSDY PR 30 2009 Mrtn Grve $829000 New cnl4br 4 bath brick hmecher kikhenmtr br utehdwdtlçec rm D644O827O Gerge Nfra 7737751855 NEW LSTtNG Skkie $279900 Sparklingiyurrfr)ed enrer nly b;kk anch le BR ree rmat gar 10193109004 Julie Naumrak 8474911855 Glenview $479000 Set back frm radpaciu ranch an verized l4br 31 bathtfin brait 10194409060 Linda Mntana 8478231855 Evantn $265000 2 bdrm 2b16 BG intage rdwd 8cr Cve mlding cep OR bymetrarhp 10883108180 DebbieSrre 8474911855 t_1 Why de bairdwarnercm make many peple happy? Prfeinal phtgraphy narrated guided tur and amazing tl are jut the tart Lve all it an extremely eay tue ite built with cnumer in mind ffering what yu want when yu want t t Skkie 9649 LeClake $449000 Ory Calif Cntemp 4/5803R Spt w/ub Updated! NR hp & ranp 2( Ott 10093109014 Julie Naurrlak 8474911055 Evantn $250000 Ruck 2 tnny 4bed/2bafrn brmnl2 car gar deal n inlawarrangernent 0093109084 Delia Jyce 8474911855 Mrtn Grve 8620 NWaukegan Rd311 $179900 Evantn $160000 MrtnGrve $157000 Spaciu 2brl2ba wet facing crner unit Gar pkg cunt Slid (reti 20R an quiet tred Newer dch bath win 2br 2ba cnd wlgarplelevalrtragelaunrlryldwd yard bldg ld820s8583 dw tir Prklng (0093 09002 hbaklg windw 10194409203 Jan trennck 7735491855 Brbi (bain 847491 1855 Linda Mntana 8470231055 Lincinwd $449000 Sprawling rancir i grt tincinwd ctg yardpatia3bciam rmlr wrpl l0l9440911 Mea Wei 7737751855 BRD&WRNER Skke $399000 Skkie $390000 Skkie $379000 Lincinwd $375000 Skke $369900 CLEN SP(OUS480 200 SPT N OESR0LE DEONSHRE mmediate pesin! Lvely brir ranth 30R/1B (rner Unit w/1400 flbr 2 ba1hheatd indr pkg Etatetale l The Terracetg 2brach mat tee3 car Devnhire pcl cum bit plit 4br 2lba g LO/OR NR PRK & POOL MOEll 10993109097 beatill hdwdt 2(gar 10103108056 Oneat cldr pani 10194409240 garage t0094409189 pdt ert ha kgr 0094409200 Jlie Naumlak 8474911055 Delia Jyce 8474911855 Dick Newld 8478231855 Phyll lacka 7737751855 irene Yngeeman 7737751855 NHe $210000 Renitance 2nd 0 1 br uniteat n krlcirenlandry n nit Ba;heated gar 10094409131 Patricia ht 0478J31055 Skke $429000 Expnd4bd/2ba/dvble ll/)umb eatn Kit/full hmt/all hrdwdndercrptl 10893109102 Charlie ernn 047491 1055 Glenview $189900 immaculate ir 2ba cndfll m bmtprivate ldydte t cprettway & bu 10194409026 Suan Bragg 8478231055 Evantn 730 Nye St $153000 Evantn $110000 Sunny tree ty unitthe Oakwd ildwd Ort rg clet Unbeatable value 1BR dwntwn cp by ii train vintage charm 10093909037 Elevatr Pr8g Cat h 10003108196 JerlGrdn 8474461855 GeiryGlbbt 8474011055 Nue Thrn ff the T and read Franklin Schl Principal Dan Walh read t children altr chl n piil 21 le evini wd Prt f 1 bmoíl Wrelc ir lark lid9euile Schl Ditrct ó4 (Tamara Bell/Stall Phtgrapher) PGE 3 ethic law clear fr apprval again By TONY BERTUC tbertuca pineer)ca)cm NUe fficial reviittr( pril 23 Ln ethic rdinrrnce that wuld create the NUe Ethic Bard and a Citizen Plan Cmpliance Cmmittee With illage Bard mcmber hailing an imprved effrt at tranparency the rdinance appeared t be n track fr apprval at the bard pril 28 meeting The dicuin cme in the wake fa rebuke by the ttrney General Office which aid the village baci vilated the tate Open Meeting ct when it firt attempted t pa an ethic rdinance The firt attempt ceuitcd lat fil) when the newly frmed ethic bard cnvened githul a publie meeting rplustees later held apublic meeting and vted n an ethic rclinance even thugh the item wa nt n the meeting agenda Shrtly afterward Trutee Kim Biederman filed a cmplaint with the attrney general ffice alleging vilatin f the tate ()n?lt irtg i\ct n ac it t t a t t i rrru treti g t he t) (li C 1 (U> t ( u t tecl v i t h l3it( kitnai i i U i vi rl e a kt t el t (5 illag ultiril rgget ng they eiit t t iue lt a J)tll)lie ineetilg illage i rney le nnunzi Sll(l Nik tticial decided t ietttti t i) the nut ter fllu(hy and cnduet all btiine at pen meeting in the intere f t ia npa enc " c;i n h a Lb e al t ntv gencial j)iflit)1) Sa id e ielated the (tten nlieting actwc art? ging te) d it thi way tt t t) be u rt" l ail "Nthing i really ging t change in he urdinance Everything i ging t be l)cfl Thi i a learning tce lr all al u Everything i ging t be evlving" t the tìect ing ltttirdry Mayr lbert Cclkt and tltt(e Luelli P(StOfl Kirn Biederman Jnc1 Je Lerde dieied the newly prped ethic rdinance and tk public crn ment Currently the ethic bard i cmped f Caller Pretn and Lerde but Caller aid 116 wuld app)itt niene t ) ttl)litlt tim atter he t a CCS t he fficia at h f flice t u rc >tue mayr Serving beneath the ((hic l)(mt( utl be the Citizen Plan Cmpliance Cmmittee which wuld cnit ()f 13 resi(leflts and S(lUld be advied by nnunzi and attrney Mike Siegel nnunzi aid the citizen cinmittee netihem had altefl(ly heemi chen but WOUld flot bc named publiely until the cnditiance va appp¼cd 113e citizen cnjmnittee vil nt have ubfuena )OW(i and ill be adviry nly lt vilf till th t the bard f trutee t make ethic ruling l)uring the dicuin lhurday Calter aid he hoped the cnjniittee titld create an ethic htline that uld put calic in direct cg>ntact with nnunzi t regiter c)1flplftifl r re P01t unethical behavii r1he nly prblem we have here i that we culd itave peple j imt calling up and making tatement that are ttally fale" Caliera aid "hie crnplainant de nt have t give their name We jut mve t be careful f call that have n meaning" Shuld the htline be created nnunzi aid it wuld be hi repnibility t invetigate cmplaint thugh he aid it wa till pible the village wuld hire an utide firm t handie the call and reprt back t him Pije current makeup f the ethic bard wa a matter f cntentin at the meeting Biederman aid the bard lacked a citizen vice becaue it wa nly talted three elected rndai Caller Pretn and Lerde "One fthe thing feel trngly abut i that we huld have a reident n thi bard" he aid Reident Rbert Kurfirt a frmer plitical cience prfer vh ha applied t be n the citizen pint cmpliance cmmittee aid he t wa cncerned that the bard which veraw a citizen cmmittee wuld nt have a citizen member "My còncern i thi being the ame peple ver and ver" he aid "Why d we Ctnci: Matt Schmitz itant Managing Editr p: 8414867273 e: mchmitz@pineerlcalcom need the middle man?" nnunzi aid it wa imprtant t have at leat ne trutee n the ethic bard becaue nly a trutee culd bring a matter befre the full bard f trutee fr a vte He al aid he believed it wa imprtant fr elected fficial t be part fthe ethic bard and nt ee it a mething that needed t be puhed baëk againt "My feat i that if we hand it ver cmpletely t the citizen there wuld autmatically be a dicnnect" he aid But aftcr the cncern wete heard Calleraid he wuld cnider rewriting the rdinance t allw nly a maximum ftw trutee n the ethic bard Caller al aid Thurday meeting wa a ign f thing t cme which culd mean the village il1 call tnte public meeting t dicu iue with reident " feel thi i the way meeting will run nw n with cmment frm peple wh care jut a much a we d" he aid Cnnent: pineerlcalcm Budget hearing May5 By TONY BERTUC tbertucacpineeflcal00fl1 NUe fficial have annunced that a draft f the Fical Year 2010 Budget i available fr review by village reident public budget hearing br been et fr May 5 at fi pm at Nue \illage 1laU ll Nife reident are encurage(i t attend and may ubmit written r ral crnment at the hearing Nil fficial ay rei dent wh wih t ee a draft fthe budget can btain ne at the illage Hall Finance Department r n nline at wwvvnilecm n ther village new the bard ftruteewa cheduled t vte n an ethic rdinance pril 28 that wuld create an ethic bard and a citizen plan cmpliance cmmittee (ee related tury) Trutee were al cheduled t hear a reprt frm the village trmwater crnmiin that ha been taked with alleviating f1din and the bard wa expected t vte n an item that wuld bid ut GPS cllectin data fwater and ewer aet Other bid award lated fr dicuin and pible apprval included rad ait fr 200910 winter ean the 2009 idewalk and gutter prgram and a fuel tank mnitring ytem dicuiñ t expand the ervice f the Nue Teen Center wa al expected (_ Sight and Sund Fr enhanced cverage f peple and place in yur cmmùnity check ut Pineer Pre vide at

GaryLii1ka 4tnew 24/7: Chèck ut pineérlcalcm fr mre LST WEEK TOP FE STORES 1 Male peratr file fr bankruptcy The Chicagbaed crn )rny thftt Znanage Glf Mill Shpping Center in Nue filed fr Ennkruptcy pril 16 but fficial were auring reident and hpper that buine will g n a uual Walgreen ffer free health ervice illage f Nue fficial want reident t knw that Waigreen in cperatin with Take Care Health Syteni ha annuncedit vill Prvide free health care ervice tall patient wh have recently been laid ff Fur ND enir ign letter f intent Fui Ntre Darne enir igned letter f intent lat muth t play cllege ftball Oaktn brief Pdlekirt hula hp and prnpadur will be winging at "Rck Yur Sck Off" the Oaktn Educatinal Fundatin pring fundraier at 7:30 pm May 2 at Onktn CrnmuniLy Cllege 1600 E Glf Rad Trutee face ptential legal entanglement Newly elected Nue trutee Gerge lpgiani will likely face a legal battie in the near future ver whether r nt he can keep hi eat n the village bard but a frmer plitical ppnent Dan Ryan ay he wnt be the ne t rck the bat Tfindtrieg t WWWpineerlcalci Plice earch fr ga tatin rbber nvetigatr ay crime culd be linked t Skkie rbbery By TONY BERTUC tberluc pineerlcal crn Shell ga tatin in NUe Wa rbbed Tueday mrning by a maked gunman accrding t lcal plice Nile plice aid a hded man wh wre a mak and brandihed a handgun entered the Shell tatin lcated n the 5900 blck f Wet Tuhy venue at 7:33 am and tle $100 befre fleeing the cene n ft Sgt Thma Davi f Nile Plice Department aid authritie inctigat ng the crime were lking int the pibility that it culd be related t anthel% ga tatin rbbery in Skkie "They are till invetigat ng thi rbbery" Davi aid "We dnt knw if the crime arc clatcd at thi ti me "\e are aking that anyne that amy lc been iii the area l lot)l)% veliuc and Lchigh \vcnuc at tha tuile t lui n)rning afl( lee! they may hae either itneed the rbl)ey r any thing tipiciu t pleae call the NUe Plice at 847/5886500 i Nib Crime Stpper at 847/588 6533 Their infòrniatin vif be kept cnlidential" Cnuie :pincerlcalcni Nue chedule tw green event By TONY BERTUC tbertuca pjneerlcalcm The village fnibe ha rganizecl tw event t help the public get greener in May Fr the firt event Spring Cleaning 2009 the village ha teamed up with GlfMjll Shpping Center t prvide a place where reident can recycle a wide variety felectrnic item Every year merican imprperly dicard millin f electrnic item that can take mre than 50 year t fully break dwn accrding t village fficial Spring Cleaning 2009 will take place between 11 am and 4 pm Saturday at Glf Mill Shpping Center tem that will be accepted include PC laptp cell phne mdem printer mnitr key bard cabie and dik drive Office equipment like telephne cpy machine fax machine ptage machine can al be recycled at the event Clthing lightly ued furniture and variu huehld l)l)lial1ee like T CR clmera blender and tater will be accepted a well illage fficial ay many f the item will be dnated t Habitat fr Humanity «j WNGS (Wmen in Need Grwing Strnger) tem that will nt be accepted include huehld hazardu wate (paint r chemical) air cnditiner refrigeratr freezer waher and dryer full lit feligible and ineligible item can be fund at wwwvnilecm The ecnd green event rganized by the village will be the Cmmunity Rain Garden PlantThn cheduled fr May 23 Studént frm Ntre Dame High Schl Envirnmental dventure Club agreed lat June t care fr the rain garden during it firt year and will ue the event t expand the garden Mayr Rbert Caller praied the prject fr it educatinal and envirnmental value "During thi event the tudent nt nly lìj)c t ee the reinvigratin! the main rain garden n the ite but the intallatin 1 tw maller rain garden and a prairie gra area" Cabler aid rfhi will allw the ela enir in the grup wh have wrked hard n the prject tciee it near y cmpleted befre graduating" The rain garden wa in talled in a vacant lt near the crner f Tuby and Harlem avenue lat June by Nife reident and 150 vlunteer frm CcaCla t pecial deign i meant t capture and filter trmwater frm urrunding building and parking lt befre it enter the lcal ewer Sytem nyne intereted in participating in the event r making a dnatin huld cntact itant illage Manager Steve inezean at (847) 5888007 Cmneit: pinecrlcalcm NSDE THS WEEK CLENDR 13 CL S S FEDS B20 CROSSWORD 618 DETH NOTCES B19 DERSONS B FLM CLPS SLlDlSHOW THS WEEK ONLNE NOW B2 Pht f the week Take a lk al the pat week thrugh the lene 01 the phtgrapher l Pineer Pre and The Oing G t pineerlcalcm pil S YOURSESON Fr cmplete cverage t yur high chl prt team check ut yureancm fr vide pht ranking and ötg Click nt the ite and elect yur chl n Wwwyureancm WEEKLY HOROSCOPES What d the tar hld fr yu? Want t knw it yur pychic Pice Mn will reveal uneen dimenin tday? Check ut yur weekly fre cat prvided by Salme Star at pineerlcalcm/tircpe FXER ThURSDY PR 3 2009 ll \ub SERNG REDERS SNCE 1951 FORUM LETTERS ML Nue HeraldSpectatr 3101W lake ve Glenview l 60026?$JUCTDM ljwdmtøn Nue HralaSpectatr (USPS 390680) 60 N19 Pubilhed reekly by Pineer Neipapeu nc 3101 Wt Lake ve Glerview L 60026 Sinqe cpy 200 Pe(OdCal1 005909e pakl at Glenw lt 60025 and additinal thce Oneyear SUbcrptin 53OD n cunty Only Call 6411 4069300 l ublcrae Plmater: Send adde chnqe Hile ll&ald Speclatr cí Pneer Newpaper nc 3T0 Well Lake ve Snde 6005 12 l cermee cwcc k cuvcrv iuc Hur: Mnirl 6:30 arn6 pm Sal 630 m12 pm Sun 8 am:12 pm Phne: (8411 48fr9300 r ucntre Phne: 1847) 4869300 Email: citculatinpineerlcalcrn Circulatin Directr Jay Beatn 1847) 4867208 OLR1 O0 Diplay advertiing Diplay ad 1847) 4869200 Emaì: mperting@pineercat crn Diplay ale repreentative Rck Branham (847) 4867283 Dipiay dvertiing Manager Dave Sherman (8471 4867320 ice Preident f dvertiing Michael Sperling (847) 4867317 Claified Sete repreentative Claified ad (841) 9983400 Email claified@pineerlcalcm Claified Saie Dectr frank Gacian (84?) 486724? rin:icur ND Puauucn Jhn Barran O POLCE BLOTTER 9 SCHOOL DDEST SHOWTME 22 83 SPORTS 27 ltam Mananq Edft Matt Schmitz (B47) 4ß61213 Email: mchmltz pineerlcal crn Fax: (B41) 4867495 Mirnqhiq EditrSprt Rich Martin 18471 486748l Email: rrnartínrpineellcalcrn Fax: 18411 3833678 Nanaqing EditrDverin Jennifer Thma (8471 4867358 Email: jthmapinverlcalcrn Fr g calendar liting r quetin email: parkertpipeerlcalcrr Gt new? New tip: (841) 4867259 Sprt lip: (847) 4867468 Email: palkrldge@plneerlcalcm Editr in Chief JeUWie (847) 4866848 Ernail: jwier@ptneerlcalcrn mertsho T(RMS ND CONDTONS aueplancel ali vider by Publiher exprely cn ddined enana lubecl l lheliiawinqlerm and cn thlifl l OCed n lbee paragraph publieher mean his pubhclin t prentll ubidiarn and afliliate derlier aqee etat Publihe habiiily in relatin l any dcl Omiin lailue publih elit in ce lninu/pcjbiihinq nl any ad wiiinnl eceed l amunt paid Tr uch d Under n circumllance will Publihec enel be liable lar any indirecl cnequenital c pecial damane r any ther cl ariing ut nr rebnd any dcl Omiin bib publih erce n the plinllnglpubblcing et an d l hn ie enpnibit dy el the dvertlel check the cclectnet et each nertn Publiehec aume n repeiblllty tn he repelilin tecene n advertíng mdered tee mre than eeinerlien eantimdbewettcephnjnqcq time n the ame day the erçrcculled Publiher teueren tieniqht llimil theamnl ctadverticq t edit r reinnt any cpy and t 000cet any adneilllng al ct cledicretln withut ntice deertlerqree t indemnity end hld Publiehee himle 1mm and aqaint any liability l r eipnne linclndin9 leaen abiedllrney Senil acllnq tram anyclalm nctudinq but nt limlied t libel ctale cmpetitin plaçlailm intrinqement t tlademarh r cpynght r nlialin l iqht et pelvacy r pblicity reulting teem publica lin bp Publihe et hn øeeitier ad ca(;os : :i5i $t:ij(l )11$f«WW wwwlneercalcm Îñc Tòwñhlpivwïiâñ charged in ambulance theft By JENNFER JOHNSON jjhnn@pineerlcacm wman rm unincrprated Maine Twnhip wa arreted thi week after Chicag plice fund her driving an ambulance that had been reprted tlen frm utide dvcate Lutheran General Hpital in Park Ridge Etera Bulbucan 25 f the 9100 blck f Nth Lincln venue wa rea fficial repnding t flu threat By NCK KTZ and R( LETT nkatz@pineerlcalcm ileavitt@pineerlcalcm S fai; at leat lcal fficial are nt taking any majr tep in repne t the wine flu intead treating it like any ther cntagiu dieae The flu ha taken mre than 100 live in Mexic but far wine flu patient in the UnitedState have recvered frm their illne fmnday afternn the Center fr Dieae Cntrl had reprted 40 cnfirmed cae in the US "t nt epidemic" aid Jackie WalkerOKeefe Mrtn Grave directr f enir and family ervice "m jut aking peple t d the nrmal thing yu wuld d during flu ean" The village hwever ha taken me tep t prvide ínfbrmatin abut the wine flu t Mrtn Grve reident OKeefe aid a link ha been added t the village Web ite t thgdcpèpe can click n that aid it will give them the latet update" he aid n additin OKeefe put tgether a flier that i available at the enir center and charged with ne felny cunt f pein f a tlen mtrvehjcle and a midemeanr cunt f darnage t Public prperty accrding t Chicag Plíce New ffair Park Ridge llice aid ecurity fficer at Lutheran General reprted that an ambulance belnging t a private ambulance crnpany waleft running near the emergency rm entrance abut 5 pm Mnwa given ut during the enir lunch prgram with infrnatin n the wine flu l he aid anyne with quetin can call vil Jage nure Margaret DiSalv at (847) 1363307G t the Mrtn Grve Park Ditrict Human Reurce Crdinatr Laurie Larn aid tandard prcedure that are alway in ue t maintain cleanline are in effect n the park ditrict prechl prgram a anitizing pray and wipe are ued t rutinely clean table and equipment a well a kid hand nadçlitin1 he aid parent areakedt keep their children at hme f they are ick n the fitne centet Larn aid heiting a ign reminding member t ue avtíilabbe tmitizing wipe t wipe dwñ equipment after they ue it "Were fllwing the ame gd hygiene prcedure we fllw nrmlly" heaid 1(i 5 i " tiperintendent cf Park kw Ele mentary Ditrict 70 aid he planited t bring up the iu Mndayafternn at an already cheduled meeting f Nue Twnhip uperintendent tq ee what ther ditrict are ding in clay but when the paramedic returned abut 45 minute later the vehicle wa gne t abut 6:50 pm after Park Ridge plice bradcat thevehicle decriptin and licene plate nurnber t a tatewide plice iadi netwrk a ecurity guard at Chicag Millenniurn Park berved a wman later identified a Bulbucan itting in the driver eat fan amburepne t the wine flu threat Fr the time being thugh unle the prblem becme mre urgent he aid he i nt planning any pecial prcedure in ditrict70 "t thi pint illini denet even have any cae reprted" he aid Zabilka aid the ditrict i treatíng the dieae like any ther flu dcumenting cae and ending kid hme if they have a fever Parent are aked t keep them hme until the fever i gne "We alway have cae f the flu" he aid "fyu dnt feel well yu huld tay hme" ischl nure at Nile Twnhip High Schl Ditgict 219 expected t get 9rne general wine flu reprting and repne guideline frm theskkie Health Dàrtment Jvlnday di trictcmmunity relatin directr Jim Sèzèpìniak aith "Once the department deciae n hw t prceed wl1get that infrntipn añd wrk fim there4 he aid The ditrict hant yet gtten any call frth túdént r parent abut the utbreak he added lance at 30 N Michigan ve Chicag plice aid When the ecurity guard apprached (he wman allegedly drve ff thrugh the park tearing u patche f gra Chicag plice tactical fficerwerc lcated nearby and Bulbucan wa taken int cutdy She wa expected t appear in bnd curt Tueday afternn Cmnent:pineerlcczlcm Chicagarea rident are quietly preparing the m elve fr the wine flu t pread here Walgreen ale f antiinfectin mak are brik in Texa Califrnia Kana and New Yrk where the wine flu ha been cnfirmed and the Chicag area where a f early thi weak it hadnt pkeman Rb Elfinger aid Mnday By Mnday the utbreak had been cnfirmed t have pread t the US and Canada t hadnt rien t the level fepidemic but it had been declared Sunday a "public health emergency" by the US Center fr Dieae Cntrl and Preventin Mndaj llini Depalit_ ment f Public Health Spkewótndn Kelly JakubekidLet it iii handful f uièt cae had turnèd upnègitive bit fha ageñeyi irdiiigitelf fr the iiñé flu tò get hthe 9fl "Were ninitrrng the ituatin arund the clck" hethid Muhd$c J kind flike a trpical trm t culd die ut r ecalate int qmethìng bigger We jùt dnt know right ñów" There prbably plenty f Tamiflu available he aid epecially after the CDC releaed a prtin f the trategic natinal tckpile Sunday Swine flu i rare in the United State: Befre the latet utbreak there had nly been a dzen cae in the previu three year r There are fur knwn wine flu virue which are repiratry dieae nrmally nly affecting pig accrding t the Center fr Dieae Cntrl and PreventiQn They can infect human wh are directly exped t pig r their excrement The dieae may have been preent in Mexic tate feracruz in February r even earlier accreing t eratect rin mencán cmpany that track infeciu human and animal dieae rea reident believed acórding t erätect that tht 1ieae traveled frm pia to peple thrugh cntaminatin by area factny hg frm accine rnanaie reiident received lat year wnt tp the wine [lu the CDCay Deerfieldbaed Baxter HealthCare annunced lat Etera Bulbucan weekend that it ha aked the Wrld Health Organizatin fr a ample fthe viru train it can begin preparing a vaccine Switzerland Nvarti made a imilar annuncement Neither predicted when a vaccine mightbe ready Mnday a wrried rnbm brught her 5yearld n int pediatrician Mark Swilw Linclnwd flice "Baically he had a cld and cugh and n fever" Swilw aid "She jut wanted t minke ure it want wine flu He reaured her but nt cmpletely "Theyjut caticeled thei vacatin t L3ÇiCO? heaid "They were in 10 day "Thi i nt rry gd fr Mexicañ tuxuith" Handwahing bèfre etiting and after cntact with ther:peple epecially neezing peple will be enugh prtectin fr mt he aid nd ipc the gàrm lat anhur r urface keep yur hund away frm yur tace bétweenhandwahing he added Cm;nent:pizcerlcca/cn

;et O O O O O O 6 Tale frm FanMÎn x i \j : :ir r w t :u:rc rf : c c xc :e1r: 3$ t : Gnbiut r21 craçe F Y9J (Q í!r; cjrr eoeif Cuit rxeç J:%LL 4LJiÍi r ie:r t um n 1 ;irr YTt CT11 :Jau7et irt S jir t j;lw bfl 1tt 31Thr?Th Z idui uin 4 alrr XY ft1 Uw Fll! 4 eimrt j? ;;u3% rtw* ci ri?1 pq Thl t tcf1 LCt3S & Tfl :v2 d it $41% CNnt1? t]ru :nr rfqn ibi ttq N11T7t e c 1Ì 2% F9 3tm23± 1tfl tiu W1tt nt1 gt1w8çnw ttw fl7m Q u*n n:iø that mt Ut N(lçrn Liunf i rr nt MRNO RELTORS 5800 Dempter Mrtn Grve 1847) 9675500 &etrts ttjjns CLL 1$ z31 $ppy SÇTCUL& Gr:4 ;cw ri Lje :r t% r ;rgth Et %Ìcrc ri cu:l 1c e pz1 :jip: JJr :erm *it tir Czii jtr r rçe umi i;: rc 2 c3r ;att iriw cd rt e:t*: _ :czci ur; ter Cr3TrCt Lr4n ttr; r & :rir ri ttp iini x F L)P ÇlJD S t ;Tn :r rt u i* rt; i g; j t i :t nn nt $tzdnç rvcn ;tw ;:m tc :1T7 z LaF axtft Lir wng cnî 3 rnrg rn%fl cvc u1 rn N4 C nlm:rf i $tia GeL UCfl ar1cutg fz;4a1&m Z c1çß )h!t wwwpineerlcalcm h Tçry te;: be cr c t E tr t Pi4epTha nd met the lve f hi ;fe t the Hile Hitrical SzrU tesg Nib TwnhiP idjj 2 O ail ar2c ti 2tat1 f :ci fl5 r1 Nr ajtwfltq r rgt t4r nr n c2 mit 2i5 flft Ur 1fl1T?d C:C1 i_ WÇ f tj ft Th r:mir rer ikr ir 1we n tie Cctand rni r4rn: t 14 2i r 2uqnmJa:)1T Tt liy 8iM k1al 1 ie n11 lai 3 1Ut1ti 2NnØlfl fl 2J1 r3ar THURSDY PR 30 2009 D Opprtunity Prgram 11u GOLD SLERS ND FLTWUM JEYfEU SCRP JEwELR1; BROKEN SCRP JEWE1R WTGiES DtMOflDS STERUG StER f3ei3 DEUL GOW and _w NCOtNS Terry Lynch dn the catme f Ben Franklin at the Nue Oai Fun Center Clubhue in Nue n pril 26 Lynch ha been wrking a a Ben Franklin recre atr fr even yeat (Shauna Bittle/Fr S1N6) PONEER PRESS PUBLCTON wwwplneerlcalcm Elew T ffrdable ecapim: Mvie theaterthriving By LZ ROCHE rche@pineerlcacm O That uual cldweather getaway t Flrida might have been a ng thi winter but rne lcal buine wner epecially mvie theater peratr ay they are direct beneficiar ie fthe called "taycatin" Fr the pat 10 week bxffice ale have been up ver the ame perid in 2008 fr Claic Cinema which perate mre than a dzen theater in the regin including the Lake Theatre in Oak Park and the Yrk Theatre in Eimhurt aid Mark Mazrima the YOUTH OF THE YER Matthew Bardela addree the crwd after receiving the Yuth f the Year award during the annual Night f Re award dinner (Jerry Daliege/Fr STNG) LKE GOOD NEGHBOR Mary Mahney react a he i intrduced a the hile Gd Nelghbbr recipient during the annual Night f Re awad dinner (Jerry Daliege/Fr SNG) cmpany marketing diiectr "Ging t the mvie i like taking a twhur metime plu vacatin" he aid adding it ecapim that i affrdable indeed SO far gd aid ndy DiOri f MC Theatre the chain that wn theater in Skkie Nrthbrk uth Barringtn and Nrridge "Weve een that when time are tugh baically guet may fbreg() vacatin r the lng Paci trip and intead turn t entertainment ptin that are cl er t bnie" he aid "i\nd mvie aie certainly right U their alley" Overall mvie bx ffice admiin have increaed ir fivefthe tht even recein year DiOd aid " lng a there till gd prduct t g ee guet till want that ecatie nd lcal theater peratt wh ay their fate i largely determined by the quality f mvie ay tlieyre relieved that far during thi receinary pend Hllywd tudi have pumped ut winner ca(lemy ward winner "Slunidg MilliOflaite" i till playing in me f Caic Cinema theater aid Mazcinia adding that he i expecting a great tart t the ummer mvie ean He anticipate everal hit including the equel "Night at the Mueum 2" the prequel "XMen Origin: Wlverine" and a new "Star Trek? mvie that "culd reinvigrate the franchie" in the ame way the "Batman" franchie aw it tar rie in recent year Din lahaki wh Oper ate Park Ridge Pickwick Theatre ay he ha a gut feeling that the ecnmy in general i ging timprve metime thi ummer but regardle mvie theater bigget threat ha never been hard ecnmic time "The glden year f the theater wa during the Deprein" he aid The bigget prblem came everal year ag during "the ppcrn care" when health expert gave ut warning abut theater ue f highinaturatedfat ccnut il fr ppping the familiar mvie treat Frlnger than theater wner liked nbdy bught ppcrn even thugh lahaki aid a patrn wuld have had t eat a "trucklad" fppcrn t d real damage O nd even that crii wa averted "We witched t canlail" he aid Quaìt alue & Service nn Lanuae Prduce Wrld NTERNTONL MRKET DEL BKERY METS SEFOOD Cilantr 4FOR1OO Green Pepper 59B Gred Freh Split Chicken Breat $i29 Family Pack LB Sara Lee Oven Rated Turkey Breat Brden 2% Milk 9 E Gal Open Pit B B Q Sa uce 99Ea180z Old Orchard Juice $ìoo 2 FOR T E 64 Oz Glden Deliciu pple Kretchmer Smked Ham $399 LB Prduce Stem Tmate 88LB MET USD Chice Skirt Steak Deli DRY qua Farm Smked Salmn $L99 J Ea 8 0e GØOCERES R ice land Ricé $99 Ea O LB Culligan Premium Water 89 h Gal Eckrich Hard Salami $i99 Sain Oli Extra irgin Olive Oil $ 99 Ea Lt Rmaine Lettuce 2FOR1OO Glden Ripe Pineapple Lean Prk Butt Rat u 59 Ea USD Chice Banalen Sirlin Steak 3?B Stella Baby Swi Cheee Dean Cttage Cheee $ìi z FOR T Ea 24 0e mìn Wihbne Dreing Sugar (lf Yarieliet) $OO Ea 4 LB 2 FOR# Ea 16 0e Bella talia Peeled Tmateai w/bai $109 Ea 28 0e 88OcTWUKEGN RD MORTON GROE L CORÑEF OF WUKEGN & L5EMPSTEF3 HOURS: MONFR 89 ST 88 SUN 87 8475811029 SLE DTES PRL 30TH THRU MY 6TH

i3evir(y fró1er9:ó1:3 8; wwwpineerlcalcm THURSDY PRft 302009 44 rthsid Cmmunity Bank Fhi u/ii1:i Take a lk at ùr new mrtgage rate tocdo UÀTES THT MErT YOUR NiE)S tow S 4625% 4756%* PR r Our ta(t i knawlcdgcahk tuid fiìcient and we will make yur purchncc r tnituc cncy nnd crleflicfle (ryu Our tnartgagc cper(ç will acict yuu frm yur l)plicfllofl t ainiplc cluin prxcç Wwwncmbaiikcm ta ntßct ur1rtage Specinlit David Pattern 8472445100 205 W Wacker 4ybUU 3127810670 wn D STERLN WTCHES CO Payuig ntant Cah TURN THS NTO HGHEST PRCES PD in 30 YERS! Our buyer have ver 50 year f experience loam 5pm N ppòiiitment Needed 5 FREE! PR(NG 3350 w Devn venue Lincinwd L 60712 y (847) 6736000 By R LETT ileavitt@pineerlcalcm lh natiìuil SCfllldfl trrunding accuatk)l1 t hat frmei Gy Rd Rlagjevich tfilclod pwer aiul n fluence ft) hefty caaipnigiì cntributin 1S given hpe t neuvit that liiifi 11 nii jin the 4G ther US ;ttite with law that CilJ) (lflatin "Crruptin ha becme the catch phrae li tate geri1e)t" aid Peter Beningei; t()llllel head t the US Drug Enfrcement gency h lu)l lead Change llini a ne hipaltisflhl grup lighting t limit Plitical cntribiltin "The prbleni i nt jut Blagójevich; it O yt ciii that allv big 11100ev t dminate what get dne arid wh get What" Hi grup l)acks tw tate bill that mirrr federal Cap arid wuld baically limit cntributin by individual t legilative candidate t $240() per l)rimary 01 general electin cycle Plitical actin cnimittee wuld be limited al t between $10000 and $20000 per cycle per legilative candidate depending upn the type fpc tatewide candidate culd accept up t $125000 fr a general electin frm a plitical party PC U thinkwe have the bet chance thiyear fany f the 12 year le been in the legilature and ve hid a bill like thi fi mt f the year" aid l3eth Cul Rl7th fgleje She a chiefpni n the lwer chamber bill J11324 Change llini hpe t hame legilatr intging alng but lat week nly 25 legilat lia igned a SpOflS fr the Hue bill and three fr the Senate bill SB 1768 Recent tate ethic hearing have brught quetin frm niembei including ptmc Bill wuld limit fil campaign cntributin llini ready fr refrm? ctivit and legilatr eeking cap n campaign cntribut in a1 their time i nw becaue vter have had enugh hj yur tale repreentative repeatedly upprted legilatin t reduce the influence f mney n plitic hw imprtant wuld that be t yu in deciding t vte t reelect yur legilatr? Hue Majrity Leader Barbara Flynn Currie D25th She nte that uperrich candidate by federal law cant be tpped frm pending their wn mney With limit wealthy candidate ppnent "wuld nt have a chance t fight back t in a January pll mre llini reident aid they were "extremely cncerned" abut crruptin in tate gvernment and the influence f mney in tate plitic than any ther iue Lat year the lp tate iue wa the price f galine "Extremely Cncemed" Z008 2009 Crruptin in tate gvernment 49% 5% nfluence f mney in putac 46% 54% Surce: Jyce rundatin Survey uld be like ging int battle with ne arm tied behind yur back" he aid "My argument t the milhinaire argument i ne wrd: Oberwei" afd Change llini upprter Mary E ndern ndern a frmer liiifi deputy inpectr general invetigating tate crruptin relerred t Jim Oberwei the dairy magnat whe milk mney culdnt get him int the gvernr manin r the US Senate r Hue Currie argue that me candidate need lt f cah t tight ff"swjft Bat" at tack by the deep pket flf"527" rganizatin and he al ha a PrWwith the bill $3OO00petcyc1e limit frm legilative eaucue t General embly Candidate "1 have a fund the Majrity Leadei Fund and pe ery mprtant 5p% Smewhat imprtant 39% Nt very mprtant 6% Nt at all mprtant 4% Pineer Per/LR pie cntribute t me and la able t ue that fund t help elect ther Deiiicrat" he aid " gue dnt ee anything wrng with that" Beninger differ "Thi i a urce fpwer and in fluence exceive influence fr the leader" he aid n fluence need t cnic frein the vter in the individual ditrict That what repreentative gvernment i all abóut" Mnèyjut help get the wrd ut Currie maintain and the leaderhip n lnger càn crack the whip like it ued t j dnt ee peple hpping t when the leader peak" he aid The bill limit buinee t $5000 per candidate per cycle which might adden member f the tate enate nurance Cmmittee aid Jeñiffer McDermtt advcacy crdinatr fr the llini branch f the RP "Everybdy want t be Ofl th?t cmmittee becaue thinurancecmpanies give much mney" aid McDékmtt in cntant trüggie t bring nile regulatin t the health jurnce indutry PONEER PRESS PUBlCTON Suburban jble rate ncreae lwing? By LYNNE STEFEL tiefel@pineercalcm There may be pitive ign hi the latet reprt f ble reident in Chicag nrth; hrthwet and :wetern uburb The unemplyment rate fn uburb erved by Pineei Pre with mre than 25000 reident decreaed tayed flat lwed 01 grew by n mre than nehaiffi percdnt frm Februaiy rate accrding t tatitic releaed Thurday by the llini Department f Emplynient Security llini ecnmy a a TieJllwing (?c!delttvee lited amng tice fficiel reprt ft/ac Ni/e Plice Department u arret (le ìit cntitute finding f guilt Only a curt f/au ca? eìiakc flint detcriiinatiiz NuES BTTERY Tmaz Winiewki 27 f705 WGrveDrive l3uffal rve wa:chargd with dmetic battery prii 2r the 1500 blck f Ehinge1Dyive le wa reeaid qn $15000 bnd wa duelli curtpril 29 BURGLRY eut wa bugiiuec pril 22 nthe920o blck f Nrth Milwaukee venue The wner reprted $300 i bu;larized pii 2inth86q0 blck fwet çnipter$tret QPSyajued at$200 vin reprted tlen DU Çeve«eley 26 f 8892 JdyLanePe Plainey w3 charged yzh driving undetu int1uncef alcq)ol andpein f marijuana pil2qpn the POUCE BLOTTER whle hwevet cntinued t ctrct The tate eanally adjuted unemplyment ftltc fi March wa 91 percent the highet level ince Nvember1985 The manufacturing ecti lt 1420() jb in March it third larget veithernnth reductin ince January 1992 There were 13200 fewer wrker in the prfeinal and buine ervice ectr the ecnìd larget decreae n recrd and the third time in the lat five mnth the number f wrker had declined by mie than 10000 Cmnene: pineerlcalcó 9400 blck (if Nrth Milwaukee venue le wa releaedl Oil SJ00() )Oiidl and i due in curt May 2f) Jennifer Niu 20 O 440 W rlingtn Ctirt Fltl man Etate wa charged with driving under the iniluence f alchl pril 25 n the730() blck f Wet Dempter Street She a releaed n $1000 bnd and i duela cuit May 27 ndiev Raanavade 25 f4103 Try StÇhicag wa chaiged withdrivingundr theinfluence f alchbl4pr 25 Qn the 7ÇÇ)0 11ckçfNrtn Mil 1)1kq 4içauc ite wa releaqd p i3oqo bnd and i due in curt May 19 raiiq 1<unhi 48 f 5304 w ddiri:st Chicag wa chazgeçlwith driving under the influenicef ll çhl prii 2 n tht 000 btckf Wçt: Tuh venuehe wxun reieaed n $1OOQ bnd and i ditle in curt May 19 ROBdERY bie;n the 8300 bi9ck f Wnt Glf Rad wa ibbed f $20() prii 23 by a man vitli atunnd ( ) r wwwplneerlcalcm newz 9 O O ree Txy PONEER PRESS nun Î00%L SOURCE O O p O a w O 001 O $25 Wetwríng Lunchen 3íCúfay nn 7vbrtui Suire/Skíe Banquet & Cnference Center 5300 W Thuliy ve Sííe C 60077 j Xeyiwte Syeecui "ljdty Language: yur Bay Syea (um i WítFwut Tver Saying a )rd" Spcaer 2ever(y Cfiaitayrviie raiie & 1ciate wit/i ver 30 year f experience in fl1enan CapiLa(Deve(piuient Ernp(yee Rlciititi aci 1efatih Txecutive 1rainhnig J[atiiiaCSyeakfiig Frfeína(Ca6aiug a weffa rreiit 7tcquiitin Strategie StrueturecÛWetwíng 7tctívítíe wífw the keynte a4íre! T Seer Wefenwi SpéciaLietwr(iiig can ítui tpfryi ekyeti! C(iana : ltecqie jli earch " acivicefrin tue Career Jteflce CenterjaOEc(ay: 1?iuege cnurtaeiifrm Efizaiietñ Strd and1macy ivitlpjviie t n yaurintçr vi«w u it a1ppfeteucapyearcince Ç : r Enter a thcniing t win an TûzauietfJ4rcie?i "ihlerijcnv ialttver" Organiiec(13y tile B:ancCWíñflette Cfial?ther f Cmmerce CaOE847 945 4660 r84721 jr mre cn7rmatíön rti_rr 4 r: Cjbnrcd6y the JJuffa(:grvc DeP(a(neEvantn (euce Q(etvie;v "Jfigfi(an(1arQ ai2e yret/ca1e B(JJ Cíicluiuiirc mncñrwd Jvire Nrtl6r2 Nrt/îfle(d lörtei Ç:ve Tari 7tiíge SCie ancí"%%innetlca Chapuiße /Cni?ner;4? SUNTMES GROUP Cent44 ) Nmir Siii OMMUNTY R TWUST COM r0 P f! tiheimer ccted irnq

F f (looter less?1lc$lill wwwp0need0cat!!! li PGE 10 WE SY 1001$ WOll)S Yu ST 1 fc Time t cntr campâign cah Thank yu fr yur upprt Tw bille i eking their vy thrugh the tute lgi tre wuld limit the amunt f eentiibuhun rend idutr rene ivß Cr dividnil buinee nnd legilative vauruc t wuld mirrr the federal gvernment limit f $2400 frm indiniduul per primary und general lertin Clet $5000 frm buinee during the cycle nd $30000 rl legilative mane Lt ld Pl llini i the me league 5540 ther alab which have me limit their campuign rincne ter huld end the wrd lud cd vicar: t time On nliugc the inidiu rle mney piny i ur tlen plitic With nile frmcr llvernr i juil n vce pilu rhdcgc anther cercee p idicted fc elling tete buine t th highet cntrihulrd hitnry f publie fhril nicdal gettigtte leginlte t uppur thee hill muld eem u alum dunk Yet bth bill are mirad i cmmittee llii hu ytemic mey prblem thut al wa crruptin t invde llinni puliti With limit eteibalinn anyne with ganelel ceurce cn etribuie an enlimited amunt f maey te "thele" candidte Bninc that hepe t lie up better delu fe themelve in tate bauine van fatten the rampuig cllera f feindly rndidete 00cc heat haice bem000 the "tan" they hun tu puy t min era live inte cnlruin d allnig dgilalive PC t vtribuic unlimited funda l their "frinid" mahe it hard fr aewnmer tie util uuecefal rampuig Oppumnetf tile limit vanled the bill wuld ulln willicuire mdidannat dminute plitical eumpaigna But illini reident hne a habit f denying deep peleted ruadidute n perennial candidate Jim Obecvei illutrate nd ther nia ith eumpaign limit dnt cw t have an ver ubundnve f millihire plitic in rie truth i penil itcret hune t great an i00000rn ver ta te plitir io rneenpta the ytem end the plidrinu ruanuuble et nf haut Cbugetllii a canilti f hipar tiva grup i leading the elurge fr limit Oeguniee cre buyed by Janry pll that feund lita mp tw prblem rapan dent identifid in the lute are rrrupti i tute gunaenmet mwed by ll pareenti d the mbaave f mey i alat plitic 154 peeecntl While Blagjevieh ha wade the tata the nabmet f tu meny jabe hi epneieeaehnald glvaie ritiaud legilatr ta rhange the way plitie i ran iathi tete Citieee huld enleet their legilatr end nh them t upprt thee bill Cmienl:piaeerlraire piwne000 Dfu and Dggy dilemma CHERYL ODONON N MOM STRKES GN Lang ag in a deckt itieg enam fue far uwant a beperteeled vardy lan inupinic hirrut anninuaty paved rping with mtr nietyby teubeg thruagli a tlighlightn wgdc Bnae he mn br with he ubeegill gene the le (ml geuvianled twurd the mri len af"ghi ucd OullL" Cta mu tite ealih ell: centered by und Clint the 000ete000 heric n 0h deer mudei; i wa deluded Yen iati Cullan alway prc d nble l truth thud mre Cufunminent lilie hn timl abrared ulf ty bgn ad luked libel liad a hrub fr a heilinc Thi ldigllighi vunempt culd hmmtunmnmitmimk:mmmimyli vti:: lit 11mm ilgvntltl nly imm ihr Ctila mmmi: Ont pnd: Oblii l vummutetml t: hapmmrmi ttmmtttcil itìmtg mni:id br C:mll:mt t t mt nie Ott Nt/C liv nl r mm tmtpm: r isofl itvogitmc l}tnv nur Kigvdf fur mtub be lve n ultimi iv vr bded tlt pimmnnu rrk aid ltipa lucky ttill tite i nivluic i the Mimnt Wantvd llumug itvrknl Klug miinily ail vni itt hi mnimi; lila ctir periled fr Olr ligbivnl hint nf duger Klub0 peci hmm hie ilghtmi dt fa pnlmmt vitip bg rittling Kiimg mitt tinud i lite Piln1 cadmmi him SitwliCivu Bg mind duim Lttnic Kirby limited bmdicmve viml ihuer timm tinti dle mu Sidlien Kig diaumeeblp le mi buine un tine itlvil f lin nrd ltmaremimug ke gena Kirby civit:eke mmiii lic1toima 0001 tt mt bmtp inletuntitt i htu imiti itu uiiummu tnmmrlh mtf vmvtmmtigiilucen fint mm mtmvknml immmlmv vmmlm himmgvvlticvn ke hirk urbin l id mvtmtei; mlto/mimimmg 111e clink tut hen bevi itimbvmittlnlc lte livit tilmmmgh lime mmiv d blc intimi mund mmya "lim:ml nnb itt my mntraet" Kimmg ptmmp dmn n hi mlmmggi bil mund livlen fr huglmmm Kimby blie vecy llmmmmntmlt bed lilie Ommidilnek imvtvh King mepnd n "it" "alumy""lei" und "dwn" Kitby repnd l "vhie" ltimmgnt hdgr frm bi pdnnipimn b duty cud cnen illempoed with germel binuil r Pmunh pdtr lcmby i emmib brikemi dhi Chel King defend ll prpevil by diehamginga gravelly wamivg bulb d guard li vnlm Kimby tll tht emry "N CO50hiy Pr Old Men" ddm mhnmv nare hiding bleuiamu: Da ynuu berce Kil0mmi lotltr/emiime ml nbriiinvhmera@ Cnttmttmtmi: btmnmitcmbenb cut i 00014 lib in btum Nile ecident inc im:mnhii peting in he mi vpn eterlin fee muy i almt BO peur i mlnnidmi hrn fe muyv bevumel rutdnt liken time ddnine nbile dur celunniby bee npeiredeated Olmulcte mble refrm mitad ttt ineenand fmmdingal many ther lhmmi ltme been eegieeted inc b len lng Bccne cf Sui rm pulga thee iue une PuncHy being debated und tha iavìrtey nhinue ta heu illage Tuute ta mhn umen bluh epuige pbnmic lt mat celity thy ay pull hir i e tugh pud udemlnd then befre eabereti lime ren n4 mud pennl eri0000 tu gine b:mrlm 1mm mm eummunity fiul lbmc much Dialrlinn tnd deceptin luid bmul un my feeiihyaid my cerned mere imply btempi h hnnhke und inhiunidle 001000 and epecially einreitie000 (Pith bhee teetieb it n mnde hai mt ubidentu ee Ottned uhf tram plicie Even with hn mhmmi lnge hat uvermuhelmed bythe tremendu ayprt frm reident cl bny campaign but bum hei cmmimmeat t mnkig Nihe an ene betten en muhy hem prud ni what me aevamphihed tgether heel feewecdtoenobmna ig O wrb tgether lut make Nihe a cmmnmly me ee il penad te nal Elte Dltedfltte lll$tettltb Candldalt le 00100

j 12 Camera lt in Naperyille Triangle STEPHNE ZMMERMNN TfE FXER Chicag SunTime wuld email me vinced that yu werent never gt the credit tlying t cam anyne n Feb 24 1 fled in We have me gd inured mail nquiry with new: We gave tui t ur the US Ptal Service w atsear and he COfltactJ Sear three gt right n it day later They wanted She baci them try tracing t gt the tracking it with the tracking flumberandmetie numberyu prvided with nfrmatin which i pr n luck (were gueing it W (1(fj On pible it cntained a March 7 the USPS typ which might explain _ Puu Uil rnw Liir recra the SlWrepne yu ininline rder with Kmart hwed the package wa tially gt) t any rate they fr a Kdak 92 MJ) Cam delve&d n Dec 4 believe yu and have iued era Bundle with a GB B?CUtJSe fthj my ptal SD memry card a full crédit fr $13508 fr n Nv inurance claim wa the purchae 27 That ame day talked denjd fr the camera wh t my n and he tldme till havent received a that he had already knw where it walked ff pur credit fr the returned chaed a camera fr t? Napervillian keep me camera Sear frze the fr Chritma yur eye pen interet n the bill a f Cntacted Kmart and March 10 but wuld like they tldme t return Dear Fber: rdered the t ee a credit fr the camera t Kmart tw et fttally Table whle purchae n ur return ffice at by Jy Mangan/Jng an Sear accunt addre in Naperville via niu Deign frm HSN Janice D Merifield inurcd mail J did thi nc a Chritma gift n Dec 2 When they arrived ne Dear Janice: t lk like They aid my Sear etdidnt have the cutm yu did all the right thing: card wuld be credited in tableclth called inuring the package fltw r three day f there HSN cutmer eryjce lwing up keeping wa a prblem they gd They tld me they nte nd we were wuld cn cntact the cmpany and Sameday mammegram appintmafl i frequent available at elect lcatin Fattrack ceduting fui diagntic prcedui T chedule an appintment call (688) 364640Q Our epleentatjve can chedule yur manimgram Screening baed n firt iity1 lcatin Or requet an appintment nline at nrflhrerg/mamgr floththo(eog 07&D$ Uciu HntthSy5m l flttli: Yu dònt have t Full range f ll reult are Eight creening!statefthea interpreted by facilitie lcated breat imagia Ourpecializet f near Chicagòi technlgy j radilgit ( including at i which reearch f Nrdtrm in i hw increae the Old Orchard rate f dtint ; Shpping Center Mre than 13000 marnmgrain i creening perfrmed per year tuactilng affiltate f the Univerity f Chicag Pritzker Schl f Medicine wwwpineerlcalcm get the tableclth ent ut t nie fter abut t() week L cmailed SN t fllw up linc eniall gt in return wa an ffer f a $10 refund fr the miing tableclth called t tell them wanted my tableclth and they aid theyd try again n the meantime earched the Web and fund a cutmer ervice enanil addre fr ngeflous l)eign and cmailed thena n March 11 laa till waiting fi a repne ll vant are the cutm tableclth that g with the table J purchaed and n mre unarund Kim Bgue Dear Kirn: \e dnt blame yu it und like the runarund yuve gtten i mie than enugh exercie Team Fixe! liad a little better luck We cntacted HSN and fund Melia Bach Jy Mangan publicil Bing! When Bach heard yur tr he aid it imit have been a "crazy mimrnunicatin" that hap )efled during the hliday She prmied t drp the tablecloth int the mail immediately and that he did Yu reptted getting them within 48 hur nd nw well cnider thi fixed Gd deed Earth Day i ver but that n rean t tp being gd t the planet Here One Way: T&T and Cell Phne fr Sldier are teaming up t give wirele cutmer fanycairier(ntjl T&T) a chance t recycle their ld cell phne t etimated that mie than 100 millin cell phne ai:e dicacded each yea! and nly a fractin f the ae recycled Recycling help ave valuable cmpnent and prevent naty thing lik arenic cadmium lead and mercury frm plluting the envirnment T&T andcell Phne fr Suldiei have a free nline tl deigned t help SPECL SPR1ÑG SLE The Bet Grill Sejectin and Service n the Nrth Shre Since 1993 dgj Slaire Brilmater Dûcane Big Green Egg lec Cutm Outdr Firepitg and ccerie GRj CLE1NNG &SERÌCE LBLE Tije Crc Timber FreeGa Lp!taltln : Otr tal Call Neal fr a Free nhme Cnujtatiny Reliable Dpndabj TrUSted Frnity Ownd & Operated fr Over 14 Year R THURSy PRL 30 20gg cmmunity grup and individual launch and cnduct their wn dnati0 drive with a new eiertrnic "tarter kit" avail able at WWWattcln/tecy clewirele l wirele cutm005 f any carrier can dip ued cell phne and accene at lcal T&T tre Mre inf i at http://wwttcm/ire le Getting the ruzar(nd abut a cnumerprbjci? Tell ft t T/ieFcr at WWÚ)pineerlcaLci whereyulljjd a imple frm tfihlut fyu dnt haue a cmpute; yu can mail a briefdecrjptj f yurprblen alng will yur name addre and telephne nunber t: The Fixer 3701 WLakcvc Glenujew L 60026 Dnt end òrlginal dcuctj Becaue ft/ic large clnie fubmij The Fixer Cant make pernaireplic Létter are editedfr length an(l c1ríf) Cninaent:pineerlca/c PONEER PRESS PUBLCTON Sbn!ifl fr Cin; n uni (y Calendar are required 14 day preceding tj date f publicatin Send t: Ni/e Maciaging Editr Pineer c 3701 W Lake ve Glewiew L 60026 nfrimitiam may befcmxed t (847) 1867495 r cmailed t nbttari@pizecrlca/cìn Center f Cncern The Center f Cncern 1580 N Nrthwet Highway Suite 310 Park Ridge (847) 8230453 Calendar f event include: Tueday Wedneday (every week) Emplyment cuneling by appintmeiit Mnday May 11 lzheimer careqiver upprt grup 10 am Tueday May 5 and 19 Medicare cuneling by appintment Tueday May 12 Center f Cncern annual meeting (public invited) 7:30 pm Park Ridge Senir Center 100 S Wetern ve Park Ridge Wedneday May 6 and 20 Grief and l upprt grup (call firt) Saturday May 9 Legal cuneling by appintment Saturday May 30 Bld preure and bld ugar teting 10 amnn (n appintment needed) The Center will be cled May 2325 fr Memrial Day weekend Center cunelr al are available t help eligible reident apply fr llini Circuit Breaker prpertytax relief grant and liceneplate dicunt llini Care Ru (precriptindrug aitance) the enrcitizen realetate tax exemptin and deferral the enircitizen taxaement freeze and the lngtimeccupanthmewner prpertytax exemptin Emplyment cuneling and pleparatin f imple wilt and durable pwer f attrney fr health care and prperty al are available by appintment Supprt irp fr lzheimer caregiver the uffering frm grief and t and enir eeking t imprve their nutritin are available at the Center f Cncern in Park Ridge The center al ffer atfrdable pernal cuneling t adult f all age Call center dal wrker Myrna Fgarty (847) 8230453 The center i at 1580 N Nrthwet Highway Suite 3)0 ark Ridge The center al ffer hauing cuneling fr enir and ther eeking affrdable huing prqram deigned t prevent hmelene inhme health care referral friendly viitr fr the hmebund and vlunteer pprtunitie in the tfice and n the field Clae TLC: Ttal Learning Cmmunity n Partnerhip with Oaktn Cmmunity Cllege lf(erinq free Family Literacy Clae n Saturday mrning Free child cure i al prvided Participant will learn abut the US chl ytem; hw t reprt a child abence frm chl; undertand reprt card: hw t prepare fr parentteacher cnference: hw t cmplete required frm; hw t help with hmewrk; and hw t participate during the parentchild activity Regiter nw Clae run frm 9 amnn at Gemini Junir High Schl 8955 Greenwd ve Nue Nte: Child care i available fr children wh are ut f diaper Call Pamela Surber TLC directr (847) 8274137 defla Clet a bead tre at 9227 Waukegan Rad Mrtn Grve ht free beginning jeweirymaking clae at 9 am weekday Call (841) 9662323 Club The Park Ridye Cathlic Wman Club meet at 12:15 pm May f at the Park Ridge Suth Recreatinal Center 833Talctl Rad Paik Ridge The prgram will be a Manan Travelgue Deert and cffee erved The annual Spring Lun chen will be held at nn May 21 at Café La Cave De Plaine Guet are invited; $35 The lunchen will be preceded by a Ma f Thankgiving at 11 am in the chapel f Our Lady f Hpe Church 9111 W Devn ve Remnt The Heritage Club f Plih merican meetat 1:30 pm May 3 at the Merrimac Park Field Hue 6343 W rving Park Rdd Chicag Marlene Wilczynka Gill will give a preentatin n cntributin f Plih menicàn wmen l thi cuntry Upcming event in Plnia wilt be dicued Public i invited Retrehment erved; $1 nunmember Call (173) 7635581 Le Bavard a mnthly Francphne dinnergrup will meet at 6:30 pm May 6 fr dinner and canceratin at a retaurant in De Plaine t practice uing the anguage in an infrmal etting Participant have variu level f prficiency in paaking French and indude native peaker f the anguage N memberhip due required T repnd call (847) 720 4502 r email lebavard@yahcm by the preceding Mnday evening Chiacchierni talianlanguage dinner grup meet at 6:30 pm n the ecnd Thurday f each mnth at Salern 1716 E Keningtn Rad Munt Prpect Thi i a cauai evening f cnveratin in tal an The next meeting will be May 14 Call Gabriella (847) 5418524 r email: ichiacchierni@yahocom LeTP internatinal a buine netwrking rganizatin recently pened a new lcalchapter rea prfeinal eeking new lead netwrking pprtunitie and valuable buine tip are invited t jin the grup which meet every Thurday at 7:01 am at Omega 9100 W Gtt Rad in Nit t each meeting member exchange qualifled buine referral build prfeinal relatinhip create alliance develp public peaking kill and take turn prmting their prduct and ervice l n every LeTip chapter each buine cateqcry i repreerted by ne member t prevent cnflict f interet (nce yu jin yur crnpetitin cannt) T learn mre cntact Janet Hanen (815) 728 1483 r jvhanen@letipcm Fr detail n LeTip viit wwwletipcm Jin the Cathlic Wmen Bwling League fr Ladie Night Out at Claic Bwl 530 Waukegan Rad Mitn Grve Fee i SS per week ll kill level welcme Call Deanne Drzdz at (224) 6284009 r ddnzdz@cmcatnet The Knight f Clumbu (Nrth merican Martyr Cuncil Nue) prvide way fr member t help ther in the cmmunity while trying t imprve their family and piritual live Call Bb Galai (847) 9650920 The merican Jewih rtit Club i accepting new member The grup funded in the early l920 fcue n the brad apect 01 artitic perfrmance and erve t enrich the cultural fiber f the Jewih cmmunity Call trre Slaw (847) 2720744 r email llaw aktnedu udubn Sciety f Park Ridge meet at 1:30 pm the furth Thurday f the mnth in the Maine Park Leiure Center Fretview and Sylviawd Guet f all age are welcme Cati Rager Ginger 1847) 8252982 The Jereypine Crumer Mtrcyde Turing Climb meet at 1:45 pm the furth Tueday f each mnth in the De Plaine Elk Club lwer level 495 Lee St (tw blck nrth f Rute 14) De Plaine Jereypme Cruier Sunday Breakfat Ride leave at 9 am frm McDnad Retaurant at Oaktn and Lee treet in De Plaine Ride are uually 25 t 85 mile Call Betty (108) 3663822 r Je (841) 217 5876 r viit wwwjereypinecruierrg Hile Chapter Tatmat8r meet at 7:15 pm the ecnd and furth Wedneday f the mnth at the Mrtn Grve 6140 Lincln ve Member learn hw t feel cmfrtable and have elfcnfidence talking t an audience Call (8471 583 9328 Cmmunity Ftne Center Mlle Family Fitne Center 987 Civic Center Dr Nue (847) 588 8400 r wwwnilefitnecm Swim Club Thi cla fr age 7 15 will teach different training technique ued fr cmpetitive wimming Requirement are: 100 yard freetyle 100yard backtrke 50yard breattrke and 25yard fly Fee are $90 fr member: $110 nnmember Glamur Girl age 611 may get ready t be pampered Enjy an evening f hair nail ltin and jewelrymaking frm 69 pin May 8 The tee i $10 fr member; S15 nnmember Fundraier Haine Center a ntfrprfit prvider f mental health and wwwpineerlcalcm CLENDR cuneling ervice in Park Ridge and Maine Twnhip will hld t annual fundraier "Cruiing Lake Michigan" n June 7 Bard at li am fr a twhur Odyey Bat Brunch Cruie Enjy a live Jazz band pectacular view Ql Lake Michigan and the Chicag kyline cmplimentary champagne fd auctin and ralle item Ticket are $95 per pern Call (847) 696 1570 Ext 308 Library Hile Public Library 6960 W Oaktn St (847) 6631234 r nline at wwwnilelibraryrg Mile Public Library the mri Earn rate that cmare t a CD withut lcking up yur mney That right yu culd be earning rate cmparable t a CD withut ling the ability t acce yur mney whenever yu need it With Cle Taylr Bank Right Pernal Mney Market ccunt yu earn mre a yu ave mre: ccunt Balance $50000 and up $25000 $49999 $10000 $24999 Le than $10000 can Library ciatin and Wman Day magazine want t knw hw wmen have ued reurce and ervice at the library during thi tugh ecnmic time Frm nw until May 18 wmen lder than 18 may ubmit their try in 100 wrd r le t wmanday@alarg Fur trie will be featured in the March 2010 ue f Wman Day which ha mre than 4 millin reader Official rule are available n the Wman Day Web ite wmandaycm/ala The G Club fr age 6 t 12 uually meet the firt and third Satur day f each mnth n a drpin nnual Percentage Yield (PY)1 bai Maine Twnhip Maine Twnhip FSH (Friend ndeed Serve and Help) in need f vlunteer driver t prvide reident free tranprtatin t mdcal facilite n and near Maine Twnhip lunteer may che hw much time they wih t devte Requirement include a current driver licene and prf f aut inurance The prgram require reident in need be mbile r be able t ue a cane r walker FSH al ak that appintment Calenda; PGE 14 Minimum amunt needed t pen accunt and earn PY1 Ret eay knwing that yure getting a great rate frm a Chicag bank yu knw and trut plu FDC inurance n balance up t the maximum allwable amunt7 Open yur Right Pernal Mney Market ccunt tday Call u at 8477632603 r 0477632602 r viit the banking pecialit at Cla Taylr Old Orchard branchat 4O1 W Glf Rad tday Me"be FOC 225% $10000 L75% $10000 125% $10000 N interet paid $10000 2 CleTa ylrbank ChicagS buine banking pciaiim nôi Pccent YeirlS PY0 e etfectiv 041009 and bjt tó M any ne iee Thy Je evn accunt F nw mney Only Reir t Cle Tayl Onk Rlt and Re9ultn Regadìng Oept ccunt l addjtnl tern and cndtln Fedel eulan nu tlndpalty peautlaed tanft t per tatement cycle n mre tan ttee (whlct may be by hrk dah deck cad Qn Odbe 3 2Q loc deptt narae tempiy lneaed he icc t lept th00h 12 31 /09 13

w 4new Calendar Cntinued frm P$E 13 be et three mre day n advance T bc a vlunteer driyer call (ii Oken (847) 696O76 T Schedule a rkle r rr in1j call FSH COOfdjflaj Glria Stepek (847) 29725 Ezt 283 Mi *d! Sp dal Recreatj eanal frchue fr Summer i "ailabe MNSR ffer peple wflf phyical and men al chafenq behavir and learning dirder hearing and viual mpairment and emtinal diajljtie an Opprtunity l enjy a variely f ecreahn aclivitie The Summer ean ffer prgram and pecial event including prt and Special Olympic prgram art cking and aerbic Lk fr the additin f many uting thi ean uch a: Camping Cnnectin Teen dventure and Tee Time Glf Regitratin begin upn delivery r the brchure MaineHile erve De Plaine GlfMaine Linclflwd Mrtn Grve Hile Park Ridge and Skkie T receive a eanal brchure r t ffer upprt fr peple with pecial need by lunteerínq call (841) 9665522 Nile Tarn O5iia Glf Cure ha re Opened fr the 2008 ean with lw rafe a midday pecial Junir N OPPrrrupny i RD YOUR HOME OF 1/tZnu WTF ìiruz PRnnUCTSJ t len itupîvj D_n 0km Fi Eflhg4b (EMPrYi FOOii DOb Fflßd runet HO*hO4d ftk Ci_ flstctcfjq *4thcle UL Pi u Ømd PaJn Hmc pl xhnl?hemtt Ud Od Wød Kdkm COU Prgram and private glf lean lam OShnter Glf Cure i lcated at 6700 Hward SL (8471 9652344 e Pt Dtrjct Pineer Park ha repnj fr the 2009 ean Thi latility ha an 18 hle minigl: cure and even batting cage and a cncein tand Partie and (undraieß are al available Pi fleer Park i lcated at 7135 N Harlem ve Spring hur are: 5D pm Mnday thrugh Friday: loe 30 ain1d30 pin Saturday and Sunday Call (847) 5832746 p_ Sitrief ffer a wide variety f ummer camp prgram fr prechl age thrugh incming eighthgrader Fullday and ballday camp prt camp hckey and ice kating camp are ffered Stp by Hward Leiure Center 6676 W Hward St t regiter Camper will enjy wmming weekly field rip art and craft and prti Mt camp begin June 8 Cal) 847) 9676633 Nife Park Ditrict i accepting regitratin fr Girl Sftball League fr girl in firt grade thrugh high chl (a f 200809 chl year) Opening Day game are May 16 Ma r League replica hat jer5ey and ck are prvided by the Park Ditrict Participant mut upply their pant he and glve Regitratin i accepted at the Hward Leiure Center 6676 W Hward St Call (847) 9671529 NUe Pari Ditrict Bright Beginfling Prechl regitratin i cnducted fr the 2009O chl year PFinC D wx ORiNO DUSinCi anti Schl Wa(ø Cmpute Eecizic Epi&v Fi:WQk Lakm Palm Udicni Wate Smie DOict Tir Bth J and 4ye?rld prgram are ffered There are a variety f cla time arid lcatin (rm which t che Regitratin will be accepted at Hward leiure Cen ter 6676 W Hward St until all clae are filled Call (847J 967 6633 Nife pk Ditrict i accepting regitratin fr the Spring Learning Gymnatic Prgram Clae are al Glf iew Recreatin Center 7800 Calöwell ve Prgram ffered are (r age 3 t l4 and include beginner t intermediate kill level Sein are Mnday r Friday evening Skill taught include lum bling balance beam vaulting nhinitramp and bar Regitratin i accepted at Hward Leiure Center 6676 W Hward St Call (847 967 1529 new 3 Pregh4 prgram i fr children wh turned 3 after Sept i miing the deadline fr the regular 3year prechl Children will experience their firt clarm experience Clae are frm 12:302 pm Tueday arid Thurday r Wedneday and Friday at Hward Leiure Center The ein run t May 21: Call (847; 9676633 Glf Haine The Glf Maine Park Ditrict ha taken a new and innvative apprath in raiing muchneeded fund (r the park and preading the wrd n energy efficiency The ditrict ffer a electin f ENER GY STR qualified cmpact f lurecent light bulb fr ale t the public frm a Light (r Learning kik Tarqeed Cmmunitie; :O0 am " r 9 tj81vd Gçve 500Jet E% G ge 60001 ELK GROE flail SCHOOL ME1#?OpOjjr WTER RECLMTON OSTRCr OF e04r0 OF CO?MlSSiQwffR GRETER CHCGO T nt j O nn kiihfn T Miy hc flp54jj Oi litl rink l* CÑj(n 5f Fpng9 Cyniaii u imnt un Srbra j tdo rnd Lny 00 l mpneerlcaf cm Prceed frm the ale f every bulb will directly fund the chlarhip prgram pnred by the ditrict The chlarhip prgram a lw children the pprlunity t attend camp when they rrray ni have the reurce t d n their wn The kik will al hue the light fr Learning teacher tlkit deigned br educatr and rganizatin leader t prvide infrmalinel material n the vemll Light fr Learning Pigram EHER GY SR ctivity Bk fr childçen a well a ENERGY STR hme ener gycnervatin and electrnic infrmatin will al be available recycling bin (Or ued Cil will al be available CEL may be purchaed at Feldman Park 8800 Kathy lane fule trm 830 am 4:30 pm Call 1847) 2973000 The Glf Naine Park Ditrict f (er the cmmunity an pprtunity t recycle paper prduct recgnizable greenandyellw cntainer upplied by bitibi Bwater wa drpped l in the Feldman Park tt 8800 Kathy Lane near the crner f Wetern venue and Kalb1 Lane Prduct that can be recycled in thi cntainer include newpaper magazine ffice paper (lax and cpy) hpping catalg mail and envelpe catalg flder clred paper and hredded paper (bagged); n cardbard r phne bk ll mney raied will fund the chlarhip prgram aliwiiig children t attend ummer camp and ther prgram Call (8411 297 3000 r g ETh Grve illage Schaumburg u il llßhfll% l; n 0e Plaine rfingtn and Rlling Meadw egtdrtfd "a1" Maj % _nn n MDJøe ON SELECT WNDOWS & ROOFNG PR000CTS : 1lJF i i i Chicag twww paperretrievercrn/ Glf Naine Park Oitriçt i taking regitratin fr: dult Binq: 10 am2 pm lirt Wedneday al the mnth plitthept bing at the Feldman Recre atin Center (May 6) Yuth Baeball: League ball i available fr yuth age 715 Prac tice begin in pril and game be giri May 16 H Sht Baeball T Ball Skill Clinic fr 37 yearad begin May 2 ht Sht Sprt: Ht Sht Sprt and the Glf Maine Park Ditrict have jined t bring variu prt clae and clinic Offered are Baeball Baketball Tenni and Sccer clae Stp by the Feldman r Dee Park Recreatin Center le detail Summer Camp (r kindergarten thrugh ixthgrader include prt and game art and craft playgrund activitie field trip pray park wimming and mre Fur twweek ein are ffered beginning June 22 Hur are 9:30 a w t 3:30 pm Befre and after camp child care i al available Regiter early Prechl: Early regilratin i imprtant t enure child a pace fr the (at 2009 emeter fiveday mrning prgram and a furday afternn prgram are ffered fr children turning 4 year ld by Sept 2009 Cricket Dee Park nw ha a cricket pitch that will be ready fr ue thi pring Call the park ditrict tr rental lee r availability ReCOflSft11Ct1 yur r1d : SiflCe i9ß4 f1jfdwfl8tj Bulne * mc Àdití i 8777791 872 10 quallje buyer See ale fopreenlallee fr detal ThURSDY PRL 30 21X19 iit ne! lire Park Ditrict t (ice Feldman Recreatin Center 8800 Kathy Lne (ne blck c/h f Glf Rad n Wetern venc1j Ni/e; r Dee Park at the crner f Dee and Emern Rad Oe Plaine; r call (847) 2973000 Reln Nary Sut el Widm at Cunber land and Granyilfe avenue in Park Ridge ffer a nceamnth Ma fr yung adult at 4:30 pm the third Sunday f each mnth priet wh wrk Specifically with yung adult and a chir that in crprate bth vice and intrument t prvide upbeat muic fr liturgie will be featured Liturgie will be prepared and preented by yung adult lt yung adult age 22 t lder than 40 married ur ingle with r withut children are invited Call Peg Barry (847) 720 7914 r email pegbarrywbjbpat nercm EzraHabnlm the Nife Twnhip Jewih Cngregatin 4500 Dernpter St Skkie tfer ntrductin t Judaim and beginning adult Hebrew clae n Sunday and mnthly Yiddih Member and nn member are welcme Call (8471 6754141 r g t wwwehnturg Reunin Navy and Marine Crp hip mate wh erved n the USS Clumbu C741CG12 frm 1944 thrugh 1976 and the USS Clumbu (55(1762) pat and preent will reunite Sept 30Oct 3 at the Hliday NTEREST r PYMENTS FOR ONE YER PONEER PRESS PUBLCTON nn Select Nahville Tenn Cntact llen Hpe preident 3828 Hbn Rad Frt Wayne N 468)5 260) 4862221 hpe4391@cmcatnet Unin Rde Schl Harwd Height Cla f 1974 hlding a 35 ; year reunin 110 pm Oct 10 at Franceca Tavla 208 S rlingtn Height Rad rlingtn Height Ct $65 per pern (include appetizer beer wine and ft drink) Email jannekbywjuncm Maine Eat and Maine Wet High Schl clae f 1961 and 1962 will hld a minireunin at 4 pm May 16 at Rman 1396 E Oaktn St De Plaine Call 847) 8234321 The January and June clae f Marhall High Schl will hld a 60th reunin at S pm May 17 at the Wyndham in Gfenview Call (847) 6164431 r (841) 6741541 WMTFM (and WMTHT) the high chl bradcating vice wned and perated by Maine Twnhip High Schl will celebrate 50 year f bradcating in 2009 Bradcating frm a mall tudi at Maine Eat High Schl the firt prgram wa aired Dec 20 1959 Over the pat 50 year the tatin ha grwn t include radi and televiin tudi at each f the high chl Plan are under way fr an alumni gathering fr tudent and faculty taff member t be held Sept 2527 in the Park Ridge/De Plaine area reunin cmmittee ha been frmed t lcate alt frmer WMTHFM alumni Cntact reunin@wmthalumnicm St Rbert Bellannine i planning an allcla lumni Reunin fr pring 2009 lumni are aked t end current cntact infrmatin including name maiden name (if applicable) year graduated addre phne and email addre lumni are al aked t hare memrie f time at the chl r thught abut the impact it ha had n life Send infrmatin t Sue Calcagn alumni reunin chair c/a St Rbert Bellarmine Schl 6036 W Eatwd ge Chicag L 60630 r email calcagnf0bc qlbalnet n alumniinfrmatin frm may be dwnladed frm the alumni page f the chl Web ite wwwrbchicaqrg Chlca9 Bwan High Schl Cla f 1969 will tage it 40threunin celebratin July 25 at Huday nn Chicag Mart Plaza 350 N Orlean St in dwntwn Chicag The reunin will begin at 6 pm Tw additinal event are ctieduled: a ccktail party in the htel hpitality uite July 24 and "day after" party at a ite till t tue determined July 26 Ticket are SlO per pern r $195 per cuple and may be purchaed by ending a check t Phylli lk 250 E Pear n St Unit 906 Chicag L 6061l Make check payable t Phylli lk andlndicate Bwen Reunin in mem ectin he Hliday nn will ffer pecial rm rate t Bwenite; call (312) 8365000 The Web ite wwwueewebcm/bwenl969reunin prvide mre infrmatin and name f clamate wh have nt yet been lcated Call Brett Wei (630) 2485405 t jii rkit i lking fr all St Jhn Brebeuf Schl alumni lumni huld cntact Libby Ryder (847) 9663266 r email lrydernjbchlrg and ubmit their name year graduated addre phne number maiden name (if applicable) and email addre and may hare a try r tell hw St Jhn Brebeul made an impact n their life mmaculate Cnceptn Schl n Talclt venue in Chicag etablihing an lumni ciatin n preparatin fr it TOOthanniverary celebratin the chl i earching fr it miing alumni l yu attended mmaculate Cncep tian Schl r knw mene wh did email lcalumniwicparihnet r call the rectry (773) 77S3833 lumni wh prefer t reach the aciatin by mail are encuraged end their firt maiden r lat name phne number email addre the year in which they grad uated alng with their favrite C memry and favrite C teacher t: C lumni ciatin c/a mmaculate Cnceptin Parih 7211 W TalcLt ve Chicag l 60631 Submiin may al be drpped ff at the C Parih Rectry during nrmal buine hur r alter Mae ir Sunday Taft High Schl cla f June 1959 will hld a 50th reunin Sept 2421 Cntact Larry Marh at lairea2u@cxnet r (103) 444 6255: Pat Santell Lutz patlutzcmcatne r l347) 259 0120): r Kent Meyer carlekentwaccelplunet (765) 362 9262) See al wwwtaftreuninl959cm Wlldwd Schl clae f 1959 will be celebrating their 50th reunin in June 2009 January and June graduating clae will be in cluded a well a peple wh were clamate metime between kindergarten and eighth grade but mved away befre graduatin E mail wifdwdo9l0giniailcm r call Kathy ndern Walh (773) 775 5011 Schlarhip The llni Sn f taly Fundatian i ffering $1000 cllege chlarhip t high chl enir wh have full r partial talian ancetry The fundatin will award tudent wh will graduate thi year frm a recgnized public r private llini high chl pplicant will be elected n the bai f financial need; chlatic achievement; activitie in high chl hwing character and leaderhip; an applicant pernal eay; and faculty recmmendatin Fr applicatin cntact the llini Sn f taly Fundatin 9447 W 144th Place Ortand Park L 60402 with a elfaddreed tamped en velpe r email lail@alcm The deadline i July 1 Winner will be ntified by ug 31 Main Sua 1k Uia Twuhip MaineStreamer prgram ffer a variety f pprtunitie fr rei dent 55 and lder Memberhip ndude a free ubcriptin t the MalneStreamer mnthly newlet ter which detail activite fr the upcming mnth Mt activitie are at Maine Twn Hall 1700 Ballard Rad Park Ridge unle therwie nted Cntact the MaineStreamer (847) 2912510 r g t wwwmalne twnhipcm Tate f Hm" trip t Greendale Wi will be frm T am6:30 pm June 16 Trip Rate $90 member S95 guet Greendale called the Ckbk Capital f tre Cuntry and nted fr unique "backward" hue in which the ar hitect purpely pitined the hme fr a better view Tur tart at the Reiman iitr Center and wwwplmerlcalcm new 115 Tate f Hme Outlet n dwntwn Greendale There will be time fr hpping with a dicunt afterward Lunch will be at the Berner Btan cal Garden in ne f the dining rm verlking tne garden Lat tp i a hitric trimbrn farm and Jeremiah curtain hue fr a guided tur n utng t ee the Cub v the Brewer at Miller Park n Milwaukee frm 3:45ll pm May 9 (the ut ng require lt f walking) The ct $70 fr member; 575 guet (Lge utfield bx eat) nyne wh knw MaineStreamer age 90 r lder are urged t call (841) 2972510 the peple can be ent an invitatin t a pecial event in May Lake Geneva and the bbey in Fntana Wi will be highlighted n a trip frm 8:30 am May 286 pm May 29 Ct $235 duble accupancy; 5300 ngle ccupancy Start ut with hpping time in Lake Geneva fllwed by a narrated lunchen bat cruie n Lake Geneva Lunch feature chicken breat tuffed with cranberry and pecan dreing with all the trimming tipn arrival at the bbey rert in delune accmmdatin relax and enjy the amenitie including the pa befre dinner n private dining rm Che between queencut prime rib r grilled almn Flren tine white enjying the und f Tm Slanleld ri the pian and hrn tp at the Geneva Lake Mueum the next day will cmplete thi vernight adventure Hakte Twl aking fr aitance n lcating gd reliable handymen n the area l yu knw f mene and wuld like t ub mit a aame cntact Theree Tully (841) 2912510 Ext 260 and he will frward a frm t cmplete Naine Twnhip in cperatin with the Ck Cunty Sheriff Of fice i cllecting ued cell phne t be cnverted fr emergency 911 ue fr enir Dnate phne at Maine Twn lall Senir Center The Wile Senir Center ffer free memberhip t Nife reident age 62 and lder and their pue Only center member may regi Calendari PGE 18 The Wmen Bard f Khl Children Mueum f Greater Chicag prudly preent the furth annual FMLY FEST fll SUNDYJY 3 11 }1 (Rain r hine) 2 Ffl Lcatin: Field Chryler Jeep Ddge 670 Frntage Rad Nrthied L 60093 Kid can afely explre large vehicle $25 per family (fr up t 6 peple) benefitting Khl Children Mueum f Greater Chicag T regiter r fr mre infrmatin pleae viit wwwkhlchildrenmueumrg/truck 4 (8L CMLvW 2100 Patrit Bulevard Glenview (847) 8326600 wwwkhlchildrenmueumrg

O 9ff NME: LÀk& ce4tña THE BBEY RESORT wwwtheabbeyreilcm t w &pi&va ( kjek 14Ju a crttt3 r wwwcmeffnebppecm wwwpineerlcalcm wwwgmndgenevacm NO PURCUSE NECESSRY TO ENTER OB WN PURCESE WLL NOT NCRESE ThJR CNNCES OF WNNNG Sweeptake tart n 4/23/2009 and end n 5/15/2009 and i npen nly t legal reident f Ck OuPae Lake Kane r Mcflenry cuntie n llini aged 21 yeat 0 kf id WtO prtithded Mailed entne mut be pmared by May 15 2009 aid recerved n ami than May 20 2t9 xate retad value (NW) l each grand prize: $500 NW f each Firt Pean $200 R f each Secnd Pnze: $150 NW! all prize: $13500 Odd f wuniing depend n the nttnbcr f ee cetnerecerved Umdt ne (1) eninypen pennn perday regaidte tmetndtentny NUain prize ubtitutin accti redemptinwitbemade exceatspn& dctehn Spnueervethe ntubtitteanytatei pdzewithantheprize tdtest pule becme unavaitabte Subject t cmpete tticaj rute avaitabte at wvw akegeneyawi cn Spn Pneer Newpaper hic 3701 W 1ke venue Glenview L 60026 Lake Geneva it alway EML: %8E wwwcrui&akegenevacm Lake Geneva wa recgnized n 2009 by the Ñafinal Trut fr Hitric Preervatin a What Lake Geneva event take place June 1 3 i 4? THURSDY PR 30 2QQ GRND PRZE Tw winner will each receive a Lake Geneva Getaway package curtey Of The bbey Rert & Spa and Grand Geneva FRST PLCE PRZE Sunday May 24 5:30 pm 7 pm Tweniyftve winner will be chen at randm t each receive fur Dinner Cruie ticket which include free pizza ff drink and a cah bar available SECOND PLCE PRZE Sunday May 24 7:30 pm 9 pm Fifty winner will be chen at randm t each receive tw Deed Cruie ticket which include champagne barding tat deert ff drink and a cah bar available T be eligible t win cntetant mut include perna! email addre and anwer The Three quetin belw ll entrie mut be received by May 15 2009 \N :ì$vm YOUR LOCL SUUKLC wwwakegenevjne(efwaßcm wwwpineilcacm nwer and nline entry frm can be fund by viifing wwwlakegenevawicm fter cmpletin mall Thi frm t: Red White & Cruie! c/a Lake Geneva Cnventin & iitr Bureau 20! Wllgey Dr Lake Geneva W 53147 quartet f áctivitie ti the cming week Seame Street live: When Elm Grw Up 1 Seame Street Live: "When Elm Giw Up" at 10:30 am and 7 pm May 78; 10:30 am 2 and 5:30 pm May 9; and and 4:30 pm May 10 al the Remnt Theatre 5400 N River Rad Remnt $15 $35 (800) 7453000 r wwticketmatercom "Tartuffe" pril 30 May 10 at Oaktfl CnimUnity Cllege Studi One GOt) E GifRad De Plaine Perfrmance at 8 pm pril 30May 2 and 8 9; 2 pm May 3 and io; and 7:30 pm May 7 $8$10 (847) (3351900 Evantn Symphny Orchetra perlòrms at 2:30 pm May 3 at PickStaiger Cncert Halt 50 rt Circle )rive Evantn r1jc prgram include the Brahm Symphny N 4 in E Minr and the Tchaikvky Pian Cncert N 1 in Bflat Minr $20$28; il5 fr tudent (847) 8648804 r wwwevatnymph nyrg "Muc f the Wrld" with Guitar fspain 1:30 pm May 6 the Skkie Theatre 7924 Lincln ve Skkie $10$15 (847) 677 7761 r wwwkkietheatrecfll PGE 01 UFO event tuche dwn at Skkie Theatre UFO Over llin with lieu invetia1r Sam Marant May 13 at the Skkie Theatre 7924 N Lincln ve 8 pm May 1: Hitry f llini Sighting: 8 pin May 2 Mdein llini Siqhting (Tinley Park and Rcklrd); 2 pm May 3 Mdern liiifi Sighting (OHare) $20 fr each event $25 at the dr $50 fr all three prgram Call (841) 6111161 r viit wwwkkietheatrerg By LuLl KUZM Cntributr lmt everyne ha ctt rnething ri the ky that lked trange: an aircraft that didnt nve like a jet r airplane c uddenly diappeared frm view r maybe a weird flah r rb Mt cha!k it U}) t an ptical illuin the reult f an veractive imaginatin t perhap accept that they might have een ah experimental craft that the gvernment want t keep under wrap 13ut thet atc adamant that they have een mething frm uter pace and in me cae even decribe alien craft creature r experience UFO r unidentified flvimc bject cntinue t By MYRt PETLCK Cntributr bby Cadabby i the new kid n the blck The 3 yearld fairygdtfl0thct intraining get enthuiatic repn frm yung fan in "Seame Street Live: WhenE1tU0 Grw Up" rç turing muical cme t the Remnt Theatre 5400 N River Rad Remnt fr perfrmance May 710: "She very punky even maybe a little bit ay" reprted actr Megan Gdin wh ha played bby ince the tur began in ugut bby ing a l called "Magic in Mc" in which the character thlk abut having truble learning all he need t mater in rder t becme a fairy ur invetigatr Sam Marant preident f the llini Mutual ur Netwrk i leading three dicuin n UFO at the Skkie Theatre (lrv LeavittlStall Writer) ficinate peple and t generate impained dicuin and argument "UFO accunt g back thuand fyear" aid Sani Marant preident f llini Mutual U1O Netwrk He i recgnized internatinally fr hi knwledge and expertie in the lieki f UFO invetigatin "lt a crck t relate UFO lut t9 the recent cifi eta Thi ge back t ancient time flaming charit Ezekiel wheel in the Bible and nt jut gdmther "But he knw ifhe keep practicing and believe in herelf eventally he will have her dream cme true" Cdici alti Fr (letail call (847) 671 5100 Rag t riche Life i tugh fr a beautiful yung wman wh i bed arund by abuive tepiter but thing take tt tutn lr the bettet in Marc Rbin verin f "Cinderella" preented by Big Nie rfheatre li arn and 2 pm Saturday and 11 am SUn(lay May 217 at Prairie Lake Theatre 515 E Thacket Rad De Plaine rlicket are $10 which include a meetandgreet with the actr fllwing the perfrmance lr detail call (847) 6040275 Wetern culture lt1 all &wet the wrld r1he called mdcin era f UFO tattcd in the 194 O with the Kenneth tnkl ighting that where the tettn flying aucer cnie frm" Matant will ht UFO Over llini May 13 at the Skkie Theatre He vil 1)1e5Ct taultimedia )t gram Hitry! illini Sighting and Mdern lilifois Sighting and lead (licuin with the audience The prglmns vill highlight llini UFO Write apprach Kid age 610 with a parent will explre nature then write abut the experience during Family lnpiiatin Patent & Child 13 pm Sunday May 3 at Emily Oak Nature Center 4650 Brumme1 Skkie larticipaiits vill receive ajoultial ( encut age thetii t keep writing Ct i $10 pet binily fr ieident $12 hr nntosident Fr detail call (847) 674 1500 Ext 2500 Tp f the afternn Kid fl funny fiat will make fahin tatement at Mad Flatter Strytelling l2 pm Saturday May 2 at Mrtn Grve Public Libtar 6140 Lincln ve Junit League f Chicag CONTCT: Jennifer Thma Managing Editr p: 8414861358 e: jthma@pfleercal00m hitry dating frm the O1lare at abut 4:20 in the 1800 t ighting in rçinley afternón and wti keen by Pjrk Rekfrd and mt quite n few peple the gufl(l crew pilt pepie recently the ma ighting ver OHare irprt in n the ramp talked t 2006 Marant will preent witnee wh aw the the reult f hi wn pernal ihvctigatin Rad" UFO frm La Grange including pecific detail Marant think central and vide recrded interview and eyewitne teti fr UFO ightiúg right llini i the httet area flw mny "We have prf we have "n and abut the area a muntain f prt that Rute 39 and cle t El UFO exit" aid Marant Pa there aie a lt f "But the evidence i intenighting and hr me tinally ignred by acaderean ut here in Chicugland in the Tinley mia and egment fgcvetnnient There i n dubt Park and Ornad Park area abut the genuine phenm nd there i a higher mcienìl With UFO Over lili dence in Frceprt llini fi thi i a chance fr t et night viin infttired bincular and g peple t engage their intellect la? ntaking fr leak" anyne t believe want l Curti ciate them t knws We are nt Directr at Skkie Theatie nted that the UFO event alne" ked abut the mt i fatnilyfriettdy recent OHare ighting "lbi i fr anyne i a public ut there Mararit nted: "1 wa an actual phyical fr thi event and we believe llini MUFON ha bject rtating cunter clckwie lt took ri the the right t tell their tiy clr fthe lc a thugh We are building ur audience ffering a (variety) f it were trying t clak t wa een hvering at CncOUte C Gate 17 at event" Cmment: pinecríocal00f New Elm hw include fairy gdnither t>) Street Live: When Elm Grw Up" cme t The turing prductin f Seme Remnt Theatre May 710 member in funny hat will read t kid and parent The child wearing the funniet hat will receive a gift certificate Fr detail çall (847) )6i4220 The eye have it Yu can celebrate Cinc de May with yur child age 5 and up by helping them cteate an j de di (Gd eye) a part f the Sunday Craft Serie at Skkie Heritage Mueum 8031 Flral ve The ct i $2 fr reideñt $3 nnreident Fr detail call (847) 674 1500 Ext aq Cmment: pinccrloculcotfl

B21 wwwpineerlcaicm THURSDY PRL 30 2 PONEER PRESS PUBUCTON Wwwplneerlcalcm diverin 113 wâtd PREMER! Muci MiNSTERS WFE r 0W3 fig 4 t:cii i My1J& ccth9 LU Q1t% cjfl iv WZft Jji WR1ERSTHE4TRLORG 8472426000 a := e f th NOW PLYNG RiTRESNDSHw p C w1np3 T1T OPENNG GHOSTS OF GRLFRENDS PST ctaç ML3tthEw M:Cc43u;f ta fath çet t rrçwieç c( Ebnezec Scrc Watf ( cctçxe th Mr1 Ci) decte th rmeflt)c ccc R3Et PG13 cc uj cc;teçl U(u$):MJt cme ie &j a th rfere Rej n th th XMEH ORGNS: WOLERNE Th X3tnrç«muia7t(pad by Hg Jjç TW1 qt h rnc Hccj the ccrc (Rentiì ) dçc aefthffa (707 rirj Rt FGt3 fc iteçe f ±c &j L/ nce &id wcre p&tij r STLL PLYNG h ERTH FGHTNG cc;ueç1teç Chann: Tturn ned n U YKS &eyjcj fht crcut th a cn t71fl Uecrece Hr)a fr rnten t eqje a SE cene a1 bei tr OBSESSED M ffre temp (il Lattecj ta a tppy nwrd manag«oda Rated PGi3 i tuia )dixnq me J9qatrLe diaki fte4 icwrtrj reneced frcn the and thematic cntent THE SOLOST repr (Rbert Dimey dr) in L age!e 1ri a bciwant but dituthej mnui bjt til; dream f a r PEftiTnance at Wa Dinej Cncert HaL Dected trj Je?içht (tnernen mia) Rated PG13 1c thecna e ernnt me dma ue and çuaq CRNK HGH OLTGE lter apprentj fallinq t hi death in the previu inta(rnent a hit (Jan Statham) racing the clck t bea! a tmer1eae pin return fr nre engeance riter/cjret Mike lieveldine and Bnan Taylr are al bach fr the Oflqng actin eztraagan (96 mn) Rat R fi frenetic trng body vi!ery thruçhf mide and qrapic euat cntent nudity and pervaive language EBC er FLent Eerm fcr the petteçn f t e:ma: rted j (%rnu Rated 17 GN * ij Eee UE rr wret jcii p cpeaç trer teen aç3 S t a;e t* ;nete cme thîi;s ae tc ÌlEtc(n c Wt:rcc4 t Thc Lcrcì (U Dae frcrn ec 9T) aitjri a h?d t eii (Efezaiy ih h rceat ac9ng Efrcn) ad tce ae a cçe c1 ncc ncnt hen Efrn cte h r)eñ clnate en tíe vxtue c( cretty ( ()?2 rrr1) Pated Ri3 ty (çia?e cne eria meefl1 tj teen t1ïç STTE OF PLY ** *: Rue Cre tar n a SìÇEÇC5EtLj Ef:tca tt e: a r*h5careftq tr t: (:a:t afreçjeenaff:i nc:cce it cheng dceri a reç ai rnrôeç r7 r u C&j F3 fc 5CE Yer:e : Cíur reíeren:e C t et d ccntent DRGONBLL EOLJTON a tjd ar: n Cha lacee nat fr çrrt ncalc(tçrantrl: Trtec:er frm fa rj int tìa na et a e d(la MaïSteraií rn iate F fcc CL tce HNNH MONTN: THE MOE teen pcp tai Yey C(TU) return t her rur& herne cn t recnnect?th the rnpe thr n Je Peter Cfiç dreçt th b creen verrn f the meqapp Diney hw (102 1flft) Rated G OBSERE ND REPORT bptar megamanac ecurity guard (Seth Rgen) clahe ith a reahife detectie (Ray Utta) hen a faher target the hpper at hi mall Jdy H (The Ft Fit iay) calte arid drected the dark cmedy (66 ma) Rated R (c pervare anguage grpl nudi1 drug te eua] cntent anij ilence DENTURELND *** M ekj1 flteqctuafty n cried cllege lad had been planning t take a tur f Eurpe befre ging t grad ch iifr up intead i(ng a niqhtman ummei jb at a theey ttthurgh anmçt There a definite uneçcijent f melanthay t the pç nç up ith a cmplkat roriane beheen ui her aid a iddty parli eteran ti incej ith the rirç amlegef4& maatenare guy (B) 007 Fil r" n) atet R fc language drug ue axt Eiva( reference LEN TRESPSS C affen and nted atrnmer learn up t capture a runaway mntar n thi endup f 50 citi fl1oe5 (90 niinj Rated PG fr cfi actin end brief hitrical mking FST & FURiOUS The cat f the riginal hie Fat and the Furiu treetracing urderccercp aga ([rn Dieel Paul Waet arei Michelle Rdriguez) reunte t but a herin imprter Rated P313 lcr intene equence f vierice and actin me exual cntent language and drug reference SN NOMBRE * * There a lightly dicncerting ta q f claic Hllywd in thi tr cf ie n the run in cntemprary lexco Sin Hambre develp tw lrae p!t a teenage girl frm H:cura head fr a better life in Tarica th the father he never Pn arid a yung gang member vi Centy reet that life and run fr ir fa eth icq[js thug in murder_i purut and unite them n a ran beand fr an illegal brder creerg n Spanih with ubtitle (B) i9 mft) Rated R fr vilence angjaqe and me exual cntent THE HUNTNG N CONNECTCUT mther (irginia Maden) wh rexate her ailing Sn t be cler t a hptal ditver he haring the bj with unfrieid(y pirit ery unfriendiy (97 min) Rated P013 tr me intene Sequence f terrr and diturbing image MONSTERS S LENS mntertied little girl help a learn f friendly mntritie prtect the Earth during an invain frm uter pace (94 min) Rated PG fr ci actin me crude humr and mild language 12 ROUNDS detectwe (Jhn Ceia) mut vercme 12 challengee trecue hi girlfnemj trqi a man wh kidnappej her fr reyen (108 min) Rated P013 fr intene equence f vilence and actin DUPLfc(y pair f crprate pie (Clive &en Julia Rbert) with a teamy pat team up t cn their be Tny Giiry (Mchaej Claytn) wrte arid directeij the rmantic thriller Rated P013 tr language and me exua! cntent KNOWNG pr!er (Nicla Cage) deciplier a mathematical cde trni an unearthed me capule that yred5 future diater Rated P013 fr ter equence diturbing image mj brief ung language LOE YOU MN Realizing tie ha c ne t ak t be the bet man at hi weddinç a grm (Paul Rudd) curt a new betfriendfrever (Jan Segel) Jhn Hamburg Clng Came P) wrte and directed the cmedy Rated R fr peivaive language incld ng crude and exual reference SUNSHNE CLENNG * * * When he realize her gifted/brderlineannying r need private chl a cah trapped ingle mm (my dam) ge int the lucrative (but extremely mey) crimecene cleanup buine with her tacker iter (Emily Blunt) picking up tray bdy part ândcrubbing arteriaf Spray pattern ff wall and ceiling (B) (102 min) Rated R fr language diturbing image me exuality and drug ue THE LST HOUSE ON TH E LEFT Thug wh brutally aaulted tw yung wmen get painful payback at the hme f ne f the victim parent in thi remake f 15e Crven 972 hckec 000 min) Rated R fr aditic brutal vilence including a rape and diturbing image anguage nudity and me drug ue MSS MRCH yung rnanwh wake up frm a furyear cma dicver hi frmer girlfriend i a Playby Playmate and decide t pickup where they feftfl Write/directr Trev Mre and Zach Cregger ("The Whitet Kid ti Knw") ctar in the cmedy Rated R fr trng crude and exual cntent nudity pervaive language and me drug ue RCE TO WTCH MOUNTN Ca ega cab driver (Owayne The Rck" Jhnn) ait a cuple f kid with upernatural pwer n a race t ave the planet in thi update f the 70 Diney adventure Rated PG fr equence f actin and vi ence frightening and dangeru utuatin and me thematic element CROSSiNG OER "Crah"tike drama abut immigrant f different natinalitie wh truggle t achieve legal tatu in L ngele Wayne Kramer (The Cler) wrte and directed featung Harrin Frd Ray tifta and hley Judd Rat ed R fr pervaive language me trng vilence and exuality/nudity Review by Biiice ngrani Mvie time are effective Friday and are cmpiled frm nfrmatin availabfe n Tueday Pleae nte that theater chedule are ubject t change f n liting are prvided pleae call the theater fr infprmatin RLNGTON HEGHTS rlingtn TheaterS 53 5 Evergreen St (847) 4630123 ELK GfOE LLGE Elk GrYe Bieterfiefd G rlingtn lit Rd (847) 444FLM «559 Glen 10 GLEN E W 1850 Twer Drive (847) 7299600 wwwkeratecm XMEN ORGNS: WOLERNE (PG13) FriWed: l:302:004:l54:45 7001:309:45lO:15 GHOSTS OF GRLFRENDS PST (PG13) FriWed: 12502153:40 5:006:401:459:301020 BTTLE FOR TERR (PG) FriWed: 1003:506:20900 OBSESSED (PG13) FriWed: l2:403:f56:l09:lo THE SOLOST (P013) FriWed: llo4:007:lo950 17 GN (P013) FriWed: 1:454:307201 0:00 STTE OF PLY (P013) FriWed: 11303:3136:30 9:40 HNNH MONTN: ThE MOE (G) FriWed: 1204:106:50920 HGHLND PRK Highland Park 445 Central ve 1847) 4323300 STTE OF PLY (P013) Fr1: 4:307:00930 Sat: 2004:307:009:30 Sun: 2:004:307:00 MnShun: 4:30LOO PRS 36 (PC13) Fn: 4:307:009:30 Sat: 2:004:307:009:30 Sun: 2:004:30LOO MnThur: 4:301:00 DENTURELND (R) Eri: 4:451:l5:3O Sat: 2:154:451:15930 Sun 2:154:457:15 MnThur: 4:451:15 LOE YOU MN (R) Fr1: 4:4S1:15930 Sat: ls4:457:159:30 Sun 2154:457:15 MnThur: 4:457:15 Renaiance Place SHOWTMES 1850 2nd St (847) 2587282 LEMON TREE (NR) FriSun: l2:303:o05:408:l5 MnThur: 3:O05:408:l5 LYMEUFE (R) FriSun: l:o03:306:oo820 MnThur: 3:306:008:20 S NYBODY THERE? (P013) FriSun: l2:fs2:405:oo730 MnThur: 2:405:007:30 SUGR (R) FriSun: 2:O02:305:158 00 Mnmur: 2:305:l58:OO SUNSHNE CLENNG (R) FriSun: 12:453:lO5:308:fO MnTai: 3:lO5:308:lO MOUNT PROSPECT Randhurt fol Euclid ve (841f 5909786 wwwamctheatiecm tlles Shw Place 12 301 Glf Mill Center (800) 3263264 11l643 wwwkeratecm STR TREK (P013) hr: 7:001000 DR LUR LE! N PRSE OF WOMEN tue 100 THS MERCN LFE Shur 700 XMEN ORGNS: WOLERNE (PG13) Fr) MnThur: l:ool:3020o3:45 4:lS4:456:30700 :309:l59:45lO:15 Sat Sun: lo:l51045al:15l001:30 1003:454:l54:456:30 7:OO7:309:159:45lO:15 GHOST OF GRLFRENDS PST (PG13) tri MnThur: l?50350650930 Sat Sun: lo:0ol2:503506509:30 BULE OF TERR (PG) Fri Mnhur: l404:lo6:409:20 Sat Sun: ll:30l:404106:409:20 SOLOST (P013) tri Mnlhur: 150500145lO30 Sat Sun: lo:50)505:0o7:45lo30 OBSESSED (P613) tri MnThur: ll54:407:20lo:00 Sat Sun: lo:20l:l54:40720lo00 FGHTNG (PG13) tri MnThur: l:204007:lo950 Sat Sun: 10:30l204007:i095O ERTh (G) tri MnShut: 2fO4:306:45900 S Sui lf452:104396:45900 17 GN (P013) tri MnWed: 12:453:306:l59:10 Sal Sun: 10:lO12:453:306:l5910 Thur: 12:453:30 STTE 0F PLY (P013) trimi Wed: 1:l510:lO Tue Thur: 10:10 HNNH MONTN (G) tri Mn Wed: 1:454:20 Sat Sun: ll:o0:454:20 Tue Thur: 1:45 MONSTERS S LENS 3D (Pe;) tri MnThur: 1:lO3:406208:50 Sat Sun: 10:4011O3:406:20850 Nrride NORRDGE 4520 harlem ve (708) 4529000 www amctheatrecm STR TREK (PC13) thur: 7:0Ol000 BTTLE FORTERR (PG) tri: 3:O05:l572Q9:20 Sat: 1040f 2:453:005:f57209:20 Sun: lo:4012:453005:15720 Mnhur: 3 105151:30 GHOSTS OF GRLFRENDS PST (P013) Eri 2004:451:15950 Sat: 1l202004:451:lS950 Sun: 15202:004:451:15 Mn Tue but: 3:305:508:10 Wed:3:30545810 XMEP ORGNS: WOLERNE (PG13) Fri l:302154:loe455 7:007:45940l0:25 Sat lo50ll401:302:ls41o 4557007:459:401025 Sun: lo50i1:40i:30215 4:lO4:557:00145 MnThur: 3:l54:l05:47:O0820 FGHTNG (P013) Fn: 2l04:407:25lO:10 Sat l502:lo4:407:25o)o Sun l 502104:407:25 MnThui: 40720 OBSESSED (P013) Fr): l:404:30750lo:20 Sat: fl:10l:404:307500:20 Sun: 11:10i:404:307:50 Mnmur: 3205:558:15 THE SOLOST (P013) Eri: 4:006:509:30 Sat: 10:551:25:4:006:50930 Sun: 10:55l254:006:50 MnThm: 4:307:35 17 GN (PG13) tri: 4:156:359:00 Sat: ll30l:554:156:35900 Sun: ll30l554:f 56:35 MnThur: 4:207:10 HNNH MONTN (G) tri: 4:256:459:10 Sat: ll:00l504:256:459l0 Sun: l:0ol:5o4256:45 MnThur: 4507:45 FST ND FUROUS (P013) tri: 4207lGl0:O0 Sal: 1l:05l:454:20T:10O00 Sun: ll051:454207:1o Pickwick MnWed: 4:006:45 mur: 4:00 PRK RDGE 5 S Prpect 1847) 6042234 XMEN ORGNS: WOLERNE FriSun: 2:t54:451:009:15 MnWed: 4:457:009l5 Thur: 4:156308:45 GHOST OF GlmFlmm PST (PC13) FriSun: 1154:l56O8:45 MnThur: 4:156:308:45 STTE OF PLY (P013) FriSun: 1:305:158QO MnWed: 5:15800 Thur: 4008:45 17 GN (P013) FriSun: l:004156:308:45 MnWed: 4:156308:45 Thur: 4:156:30 STR TREk (PC13) hur: 7:009:30 Gaider 16 SKOKE 220 Old Orchard Center (847)6134105 wwwamctheatrecm Garden 713 175 Old Orchard Center (Bill 6740072 wwwamctheatrecm illaqe Cring 7000 Carpenter Rad (847) 6138486 wwwkerate crn XMER ORGNS: WOLERNE (P013) tri Sat: lo:151o:511:l5f 1:451230 l:001:302:0o2303:ls3:454:15 4:455:l56:056:307:007308:00 8:459:159451OEl510:45 ll:3012ol12:3ß12:55 Sun: 101510:45l 15ll:4512:30l:OO l302002:303:153:454:154:45 5156:05630700L308:00 8:459:1594510:l510:45 MnThur: 1230l:00:3000130 3:l53:454:l54:455:l56:05610 1:O0T308:OO8:45l5 451O1510:45 GNOmO GRLFRENDS PST (PC13) Eri Sat: U:01220350320420 6:151:15859401151220 Sun: UO122O150320 4206157:158509:40 12201:50320 4206:157:l58:509:40 BTTLE FOR TERR (PG) 3D Fri Sat: l0:3012:40250 5:OO7:l0S2ll:40 Sun: 10301240250 5:001:10920 Mnhur: 12402505:O01:10920 OBSESSED (P013) Fn Sat:12301203204:106:1O 7:OlO100C1l:501240 SunThur 12301203204:10 6:lO7:i09:l01000 THE SOLOST (P013) Fr) Sat: Th3012:502203:505:lO 6:5075095010401230 SunThur 113012:502203:50: 5:lO6507509:50l0:40 Tff NFORMERS (R) tri Sat: 12:00240520 7:4510:lO1255 SunThur 1LO2405201:45lO:l0 FGHTNG (P613) Fr1 Sat: 1150230500 7:3010201250 Sunmum: :502:305:O01:301020 STTE OF PLY (PC13) Fil Sat: 1210tOO3:154006:15 72092010:151220 SunThur: 121O103:154OO 6:15720920015 CR*: lon OLTGC (R) Fil Sat: 12403005:40 8:10OE3S100 SunThur: 12403:OO5:4D8:1O1OE35 17 GN (PC13) tri Sat: 12:lS1102:5O3:40530 6208:O09:i5O:3011:45 SunThur: 12:l5:l02303:405:30 6208009:15l0:30 HNNH MONTN (G) tri Sat: :304:407:159451110 SunThur: :304:407:l59:45 OBSRE ND REPORT (R) Fn Sat: :504306:45955)215 SunThur: l:504306:45955 FST MD FUROUS (P013) FriThur: l:404507:401o:45 MONSTERS S UENS (PG) 3D tri SaL 11402:0430 7:009301201 Sunhur: ll402j04:307:o03o KNOWNG (P013) tri Set: 12453:456:40940l2:45 SunThur: 2:453:456:40140 LOE YOU MN (R) Fri Sat: 12203:l06:059001:40 SunThur: 12203:l06:05900 1122 Centra ve WL MElT E (847)2511411 STTE OF PLY (P013) FriThur: 2004:307:10 GOMORRN (NR) Eri Sat MnThur: 2104:45720 Sun: 2:10 TECHER TLES LE Sun: 6130 4610 Nrth Harlem venue flurwd lcigbt hne: 70$8674072 CRRYOUT SPECiL 8 Tac Rice & Bean Chip N Sala Ftd$ Cafflf L Fvt c ; PLat $1089 uul L wllal t_ p rdlv WlJY*4GWN LOfl1 %7?2 r ad "SPECTC U LR! Remarkable in every way even better than March f the PenguinÍEarth i a breathtaking mtin picture achievement" :: :;; "ERTH SHOULD NOT BE MSSED By th time th&credit rll yuiikely wnt wrn Pt end" "BRETHTKNG" "N EXÇEPTONLLY BEUTFUL FLM " "WENSPRNG" NE$nture "GORGEOUS! "STONSHNG" EXPERENCE THE ERY FRSTrpnaturé FLM FOR T)CKET $ff wwnyaith Ofl ThETRE SOX OÇRC NOW PLYNG Fn T**n a &wra cac cai ham OR Text c:mi MH vunzlp ODETD 43K1X (43549) Sø«y NO Pûu O 1$1 dniycm/earth

B4 STGE Blx weat pintillim turn Seurat painting int muical Sunday ki the Pr With Gerge thrugh May 7 at 8 pin Friday and Saturday 2 pm Sunday at Prafrle lake Theatre 515 E Thacker SL De Plaine $20 $18 fr enir $12 fr kid 12 and under (847) 6040275 r wwwbígnietheatre rg By STEPHNE FOSNGHT Cntributr On prii 17 a week befre Big Nie Theatre "Sundayin the Park" pened directi Rick Piendt want t be fund ntage with the actr 1101rn even backtage examining prp ntead he high up in the air n a ladder helping t et up light cue fr the even l)rfeinal highintenjy prjectr that have jut arrived at Prairie Lake Theater in De Plaine "Were dealing with per SpeCtjve iud tday" Frendt ay after he decend a ladder t explain the new hw demanding technical requirement "Many f the prjectin verlap and theyre at very teep angle we ue a ftvare package t prject at the crrect genietr" The 1984 Stephen SndheimJame Lapine muical abut artit Gerge Seurat creatin f the pintillit materpiece "Sunday fternn n the land fla Grande k kd i i Ty Jâ T anne Wlf PRDECOM "Laughutud funny and refrehingly mart The perfect way t tart the ummer!" Mike Swn WB OO "Hilariu! McCnaughey and Garner deliver" flm Fergun BCW "Funny and charming a mutee film!" Stuafl Lee WNYXW Jatte" i revered fr it remarkable pintillit cre and fr it thematic explratin fhw art can bth ilate and embrace The hw pened lat Friday at Prairie Lake the perfrmance hme f Winnetkabaed Big Nie Theatre and run weekend thrugh May 17 When Frendt agreed t direct "Sunday in the Park with Gerge" fr Big Nie he knew it: wa a tnar cmmitment Nt nly have the lat few mnth been pent in cat rehearal but Frendt devted the entire lat yeai t learning the animatin and ftware kill he needed t create a hw integrating ng dance 19th century art and 21t wwwpineerlcalcm century technlgy Seuiit becaue f hi early adptin f l)int illini i ften cnidered the art it je riginat r nl tll pixel aiul i revelc(l by the wh currently vrk in digital nied in" Frendt aid Like the 2008 Thnda revival Ftendt and the tean hnr Seurat by uing digital prjectin f ketche 1it11ti()flS tid l(lpe t h:tt event ci fly cne tgether vith flic fie character t create a three dirueninal ntage verin fseurat lìnmu painting the riginal f cure hang nt far away at the rt ntitute f Chicag "ii thi vay Seurat every l)iflt tiúke and THS YERS SEXEST THRLLER DRS 8EYONC L ELB NOLES [RER pencil ketch can cni t lift beibre the eye f the at(liptlce becming charfl(tes in thenelve" liiict 501(1 iiul jut een clay l)loe the hv pened the diipcti and hi team veie COlitLilled nt nly it h directing the inging and acting but al with tak like etting up the l)ojcctos lithe ccii dnt line up %t? hae t g U) 30 feet in the air with pipe wrenche ticj niake the tiniet little adjutment" Fenclt aid unding clearly fctrated Peple wh d thi 101 a living prbably think nthing f it" Like ther member f Big 4ie!iendt ha a day jh chemical engineer in hi cae and he been n O t li!) ka riling cuie fr nil 01 t h het hei he a taking an aninutii e()ur1 w ket(hi1g the t \f) ( k g t hat Gerge SDY4PR13Q9 ing t at ne pint "ft irnic that ne f the hw main theme i the difficulty f creating art lt ak why in the wrld artit d it The character f Gerge/Gerge tluggje with that all thiugh ct and ànd a cmmn lyric i rt int eay " Frendt aid "By he aid it!" Hwever nthing wrth having huld cme eay he reckón Even in the midt f latminute arrangement fr a hw that i muically technically and thematically diffi cult Frendt keep finding himelfpulled back t the magic f creàtin "There a yearning t d mething that beynd urelve" he aid That the payff lking at rne thing yuve created that didnt exit befre and nevec will exit again in exactly thi way" Ciiincnt:pineerca/cjn PONEER PRESS PUBLCTON wwwplneerlcalcm diverkrn 05 %H What t d ThiS Week and bynd Yu WNT N? ÑERES HOW» Submit ; event ne week prir t the date f publicatin )) Entrie mut be typed Wererry but we cant take it ver the telephne We prefer email ubmiin pleae: )) 90 litng are free nclude brief decriptin f the event time date addre price and phne number» By mail: g d Pineer Pre 3101 W Lake ve Glenview li 60026 Email: gl@pineercalcm FX: (847) 4867451 STGE Rmal Zenzele" B pm Mayl2 89; and 2 pm May 3 n tr(wetern Uni verity Ethel H Barber Theater 30 rt Circle Drive Evantn dapted frm J Nzip Maraire nvel Zen zele: Letter fr my Daughter the pernal and hitrical are cmbined n a erie f letter frm a mther t her daughter cncerning cultural inheritance and traditin the truggle fr Zimbabwe independence and the trial and tribulatin el frican wmanhd and identity $10 Call (847) 491 7282 r viit wwwticnrthweternedu "Diappearing ct Stade By Hik4al Ggl7thruqhMay3latPivenThe atre 921 Nye St Evantn Curtain at 7:30 pm ThurdaySaturday 230 pm Sunday Ticket: $25; $23 fr tudent and enir Theatre Thurday: $5 ticket available ubject t avail ability (847) 8668049 i ued t lve _ Hipflp Chremarriage" at 8 pm Mayl and 2 and 8 pm MayZ lrrnrthwetern Univerity Theatre and nterpretatin Center 1949 Campu Drive Evantn $5 Call (847) 4917282 r viit wwwticnrthweternedu "The lluln at 8 pmpvll 3014ay 2 and 2 pm May3 n Nrthwetern UnverityS Jephine Lui Theater 20 rt Circle Drive EvantnTicket: $20; $18 fr enir citizen: and $10 fr tudent and chigren Call (847) 491 7Z82 r viit wwwticnrthwetrnedu Jeu Chrit Supertar" tarring Ted Neeley at B pm pri 30 and May 1; and 2 pm and 8 pm May 2 at the Remnt Theatre 5400 N River Rad RemntTicket: $35$69 iit wwwticketmatercm r call (800) 7453000 "The Ueuterant f nlhmre thrugh June 7 at Nrthlight Theatre 9501 Skkle Blvd SkkleCurtaln time are Tueday at 1:30 pm (except May 19); Wedneday at pm (except May l) and 7:30 pm Thurday at 7:30 pm Friday at 8 pm Saturday at 2:30 pm (except May 2) and B pm4 Sunday at 2:30 pm and i pm (except May 17 31 and June 7) Ticket: S25S55; $10 fr tudent Preview thrugh May 6 $25$50 Ticket fr the pening night Mayl are $75 and nclude a pthw receptin with the cmpanyca!l (847) 6736300 r viit wwwnrthlightrg Next Theatre Cmpany will preent three perfrmance f "What Yu Need T Knw: The new play wa created lhrugh Next Cmmunitie methd f pairing cmmunity member with a tcal playwright fr inilepth explratin f the iue at hand The 15 wrkhp participant will perfrm the 40 minute play which will be fllwed by ädicuin Perfrmance include? pm pril 30 at BC Cultural Center and Café 1823 Church St Evantn; T pm May at Evantn Twnhip High Schl 1600 Ddge ve Evantn; and 2 pm May2 at the Nye Cultural rt Center 92? Nye SL Evantn dmiin i free; dnatin will be accepted at the dr Reervatin are uggeted; call (847) 4751815 ext 2 g PGE D6 Leukemia? Lymphma? MDS? FREE Treatment Optin Cnference fr Patiènt and Familie Saturday May 2 7:30 am untfl i :30 pm Fur Pint by Sheratn Chicag OHare 10249 W rving Park Rad Schiller Park Prnid by CardMal eniardln Cancer Cntn Speakeri nclude: C1eman Jeica ltman MD Rbert H lune Cancer Cnter at Nrthwetern Unverty Willi Nvurr MD NMDP Medical Directr Tranplant Service Snall Smith MD Unverity f Chicag Medical Center Patrick Stiff MD CardinalBernardl Cancer Center at Lyla Unverity Medcal Center PONEER PRESS øu LCht UCt Parameiwaran enugpal MD: Ruh Univerity Medcal Center David e0 MD Lyla Univerty Medical Center Free Parking Cntinental Breakfat and Lunch Regltr Tday wwweukrniareearcliorq r call Lnda at 8474240600 cb pfeu9ç Oxi*ech Cepha)nl gerizrne j LtSflRWHqjOvE S WR BS 3HNtR i}11niì1ñ 1alffÚídflhli t : n w/ i MTThEW J8fl MCCONUGHEY Gujg GHOST$ò GRLFRENDS PS : tiij tflw ffl 1;t: ait 1Tf 1t at ipn idjj rn!" NOtti OhmS ) Tn nl S : g O? Cubi t um 1434i f;? STRTS FRDY MY CHECK DRECTOflJES OR LSTNGS NOW PLYNG CHECK LOCL LSTNGS FOR THETERS ND SHOWTMES i iw e**ccp FOBTh ENOcj Sctt Sumerak a Gerge and Jeny Wailewki a Dt Nple Theatre prductinf "Sunday in the Park with Gerge" :f; :LL::» : FÌRE edneday 9 3Upirt * navypierco Saturday

S SUNTMES NEWS GROUP SPECL DERTSNG SECTON Nen NORTH ED)TON PRL 29MY 1 2009 The bet f everything fr anyne : S uu inide nu Livability and privacy Spaciu luxuriu twnhme ffer a higher level f living Page 7 Special tur hw ff all range tyle feature f new remdeled hme the rbut repne frm area hme builder t the Greater Chicag Hme Tur the Hme Judgingby Builderciatin fgreatercliicag i ng a large turnut a it debut hme n a turdefrce panning three weekend and fur cuntie nd it all fr yu Tue Greater Chicag Hme Tur will pen many dr t new and remdeled hme n May 23 910 and 1617 Featuring the bet f new huing and remdeled prject the Tur hwcae innvative deign and tateftue art technlgy and prduct iitr will ee me very impreive reidence priced frm $200000 t mre than $5 millin Opening it dr t the public n Saturday May 2 and running fr three weekend thrugh Sunday May 17 frm 11 ani t 5 pm the Tur vil diplay the wrk manbip f 17 builder and reindeler at 25 ite thrughut the Chicag uburb frm River Fret t t Charle frm Mareng t Spring Grve frm Mrtn Grve t Lincinhire and many pinte alng the way Reidence feature amenitie and deign element t appeal t a wide range f buyer preference New cntructin entrie are pen thrughut the Tur with the r g The recent ubprirne mrtgage me ha a lt in cmmn with the FH and HUD candal f the 1970 Read Dn DSai Page 7 Spring i in the air and the ean i perfect fr viewing mdel hme Page 3 fl nline un Yur nline urce fr market new expert advice neighbrhd prfile and mre iit: Tll Brther Carmel mdel at Hawthrn Wd Cun try Club i ne f 25 hme included in the Greater Chi ; cag Hme Tur a catteredite tur f new hue and remdeled hme running three weekend between May 2 and May 17 t SERCH CHCGO) cmy earchchicagcm/hme The Hme Builder ciatin f Greater Chicàg preent the nnual GRETER CHCGO HBGC THE OCE OF THE HOME BULDNG NDUSTRY Cutm Hme Tur May 23 May 910 & May 1617 11 am 5 pm Remdeled Hme Tur Open May 1617 Only 11 am 5 pm iit wwwhbagccm fr directin & mre infrmatin! rthur J Greene Cntructin Brackmann Develpment Grup Mareng Catlerck Cntructin Kildeer Dree Builder nc Crytal Lake area Etnp!c Cutm Builder Lng Grve/Kildeer area R Franczak & ciate nc Palatine Gertad Builder McHenry ntegrity Hme nc nverne ntegrity Hme nc nverne KM Builder nc Spring Grve Merit Hme Libertyvilie 1 Michael incent Hme t Charle a Mihvilvich Cntructin nc Spring Grve Oak Deign & Cntructin Oak Park Orren Pickell Deigner & Builder Elmhurt ttendee receive a cpy f the 2009 Greater Chicag Hme Tur magazine ($5 value) Orren Pickell Deigner & Builder Nrthbrk SeBern Hme nc t Charle Tll Brther Elgn Tll Brther Suth Barringtn Tll Brther Hawthrn Wd Spnred by: Ml veri n tome HULDEtu Tll Brther Hawthrn Wd Tll Brther Glenview Tll Brther Mrtn Grve Wynwd Hme Prairie Grve Wyiiwd Hme lgnquin mcat

The bet f everything fr anyne Speca tur hw ff all range tyle feature f new remdeled hme the rbutrepne frm areahrne builder t the Greater Chicag Hme Thur the 1lme Juclgingby Builderclatin fgreater Chicag i anticipating a large turnut a it debut hme in a turdefrce panning three weekend and fur cuntie nd it all fr yu The Greater Chicag Hme Tur will pen many dr t new and remdeled hme n : May 23 910 and 1617 Featuring the bet f new huing and remdeled prject tue Tur hwcae innvative deign and tatefthe art technlgy and prduct iitr will ee me very impreive reidence priced frm $200000 t mre than $5 millin Opening it dr t the public n Saturday May 2 and running fr three weekend thrugh Sunday May 17 frm 11 am t 5 pm thefur will diplay the wrk rnanhip f 17 builder and remdeler at 25 ite thrughut the Chicag uburb frm River Fret t t Charle frm Mareng t Spring Grve frm Mrtn Grve t Linclnhire and many pint alng the way Reidence feature amenitie and deign element t appealt a vide range fbuyer preference New cntructin entrie are pen thrughut thetur with the Turn ttour 2 Tll Brther Cannel mdel at Hawthrn Wd Cuvi try Club ne f 25 hme included n the Greater Chicag Hme Tur a catteredite tur f new hue and remdeled hme runningthree weekend between May 2 and May 17 GRETER CHCGO SUNTMES NEWS GROUP SPECL DERTSNG SECTON Neai NORTH EDTON PRL 29MY 1 2009 The Hme Builder ciatin f Greater Chicag preent the nnual ij L W t : j;;:: HBGC THE OCE OF THE HOME BULDNG NDUSTRY Cutm Hme Tur May 23 May 910 & May 1617 11 am 5 pm Remdeled Hme Tur Open May 1617 Only 11 am 5 pm 9 iit wwwhbagc1cm fr directin & mre infrmatin! inide ui Livability and privacy Spaciu luxuriu twnhme ffer a higher level f living Page 7 The recent ubprime mrtgage me ha a lt in cmmn with the FH and HUD candal f the 1970 Read Dn DeBat Page 7 Spring i in the air and the ean i perfect fr viewing mdel hme Page3 un nline uu Yur nline urce fr market new expert advice neighbrhd prfile and mre iit: SERCH CHCGO) cmy earchchicagcm/hme rthur J Greene Cntructin Brackmann Develpment Catlerck Cntructin Kildeer Grup Mareng Kildeer Dree Builder nc Crytal Lake area Empc Cutm Builder Lng Grve/Kildeer area R Francrak & ciate nc Palatine Gertad Builder McHenry ntegrity Hme nc nverne ntegrity Hme nc nverne KM Builder nc Spring Grve Merit Hme Libertyville Michael incent Hme t Charle Mihvilvich Cntructin nc Spring Grve Oak Deign & Cntructin Oak Park Orren Pkkell Deigner & Builder Eimhurt ttendee receive a cpy f the 2009 Greater Chicag Hme Tur magazine ($5 value) Orren Pickell Deigner & SeBern Hme nc Tll Brther Builder Nrthbrk St Charle Elgin Tll Brther Suth Barringtn Tll Brther Hawthrn Wd Spnred by: M*øl veri n Tll i3rther Hawthrn Wd Tll Brther Glenview Tl Brther Mrtn Grve Wynwd Hme Prairie Grve Wynwd Hme lgnquin (Emcat

tnt 2 PRL 29MY 1 2009 SUNTMES NEWS GROUP NORThU Tday NOW Hme Tday New Hme SORTH0 SSNTMES SEWS GROUP " PRL 29MY 1 2059 3 Tur FROM PGE remdeled reidence n view thrflnnleekevd Mey lut Wheller ynr n rmply neter llcing fr a mainlevance free lifetyle a grwig faatily eeking a cme aln pleaty nf iadnraad ldnnrliving pace i a lpraled ekl Ufrief nr an elablilied hmewner en lmplting ee000ali f pr mining reidence hr Tr ha hme pn dnwani mi" aid Dan Ungrlmiderpreideal flhe Hme Glletee cia lin "Cidrriglhrqnalilyf lvelry fhemgef ptin che frm and aeìlblr U ancig there are aine mce linal ppelllim nt hrem fr hyem right rw" Paelicipfingbildmm arm cn inemd that grwing cnmme cnfidence tw ilerenlmale and 1km qualify and wmlnnahip ri dent iv the hme va fhmthr will all generate nmm real 001bhp i0 emlbhldrm making the eamifrnmhintimm ad laffing lfalrrwulliylrpmjmel Tall lrlfrr a rcgnird lnryhwrbïldemliamajr tke i lhmtor willi in 00f rien in Ulgin Oteeimw Hwl finen Wd Mmt Grm and Slk Burehngl Wynwd Ril dem hua tepped np mill hwing ha CrwtulLukraadlgnqin trgrilp Hme w feteig w prpertie in Barringfna/ln vmraen and Orme Pichmll De Lnhewd a Cretad hameln ign in hwing klh a 00510m MeHemyandaBraehmannre new cantrclin kmm in Ulm ideceinmaregn Up and cam hmlandahigkrndrmmdmling ing Spring Grm fenlare prject n Nrlhhmk lfmrbngfmm Mïheilvich and h Li nf the Remdel era Cuncil "n rrapnne t market cnditin were Rtr ta great lengthn t "Hnmemnmraarermkingin KLM; Emprn i hamng in e nlinne prduct nnvatin and nvalim trategie and mmalice LnngGmveMrrilflmeniLih perd p emrate daten a mm can idea na hw they can bent ait erlyïflmad R l macnuhitapal prbde tt utin ta hr haildera their need and family lite afine Kane Cunlyreidenem ad cnnmem ner" ntplm"naid LiaaPiehmll Hae& elerthrminmilklvnstchaele "n ke lauf i mnth weve Hme Tar cchaieper ite frm SeSeen and Mchael aanekedtheullimatecanement "Thi year Tue rrpmenet a incent and Oak Park bnnd hmily uf prduct nthathuild grral cr mclin flylrand Oak Deign and cnlrcfinn er can keneul rm reduced budgrl repreenting bth new nprnammcmnlrmmdnling mj ahrtimmadnt Cnumer enlritclinnandrenatinl ecllnlhe pthlic in RimrFeet inill realinm tax dedlin ge lendmmn ame aert Cmm away Marin Windw & Dr nmledkythnintallalin f high impreed and inpiend by ke and Yerman Wirele ammlbr ymncegy efficient ewprdct" enr f prject hwcaed" pnr h The Nrthwet uburb re "Marvin Windw & Pane "Wrern bth the replace well emprrentmd milk hme in ha madn nklanhialcmiiif ment and hr nwctmacti Kildemm frm nline J Gramme menitahlgmnntftheh marhetwith tleringn thai mmml nnitcallmnhvudghnmm in ing idntry" unid Sctt thekighntludumd"femegy U maldg b dbt hthgnupei Hue Tatu Walbridgr reghnal ale man ugrr and nuciale le preident GRETLOCTON GRET SCÑOOLS GRET PLCE TO LE efficieny and dmruhll blp peed ch tha will benefit hr build era the hamrannmma and the mairtmenl" Free adminin al hm 2trar lcatin include a cpy nl Hue & Hme 20f 9 (u t alue)tr ffical magnube nl thrturfeatumudelallalenek hme unwell a ilemnline ne linen and valuable remdeling tip Maganine are anilablr nl all enzan Wirele retail lca ha all US Bah branhe Marvin Witdnm& Dr hw ram and thrugh ke Hme Builder iatia ffice in ddinan Mre detailn diem liu n the hme and entry klanhn fr dr prize drawing nne available ut wwwhbagc Tday New Hme nntfrcdtlnapmn000adnyfmaypahllm101n aaarth Cnnr Clan 010200 Ouvra 1111mb Editrial dvertiing TaunrMalllnna Pannaenun 147j45ttltblnhupbanneb000iann atna47 plbawafknm vaamnammnnuaa000aia0000 ttltt41t4;nubltmnnaptunn mn inmmltanlbbbppa 18411119tttt yarnppauprarantaaniaan nur DnrlmePakay atltltt daalnaaatnnn anima UilWnal tobattltll nabahuxaaataan mil 2mWbn tl;ttn)fma4tu taablnmauprnnarinaaimn Only frm Cambridge Hm: FFORDBLE Lake CnS1 Livivg! The yu want at ñéw lw price! wide chice nf inglefam(ly hma deign rvhnule frm gtnal glf lake Michigan beache ted hpping nl Grnee Mill Cmbnidga bring yu li f lka Cnnlyu bnll Spring the bet time t view mdel hme ev Mmcy Muten apalol na auline aw np Speirginir ihm alb and many cmmnnitiennemvllthingvppr nulen t lew their mdel hmen lpan rm n hr mrhet fr a tmmwhnme be ure viit thrrl000lcmmnniliennvd rm whathitmyhave tter Three mdel hm Warningl Cmlry nd Rrivll repenntleivglnfarka cmmily f 125 lwt we ill De Fable Develped by Len lagln Hme hr cmmunity ulfer hrer llave plan rgbg (rm 1605 l 1913 quare feel They are hae priced frm $240000 l $264900 The fwealry hme feninre w hrer bedrum 2t ablh and au al lacked twcurgarage "Lexingtn Frk i he limb newctmcli lwnimme cnmmuvilp im Den Pnte n lfmrbmyrrlhmclmarmlnqlet uburban elling plu nebn uaenienee uel u cebil evbeef aiummnl and public ranpm lntianplbnwilhinlnllmpal lhriefrnl de" aid Jeltßnch cprincipal f Lengbav Hme "nd thee cilpl ihm characlemilic enlmnd ke dr ign flhe hme au well mll tandard tealure uch au Jalimte bulcnimu and mlghlfnl fmnbdru hal urn mre 00m mn in clip deelpmml" The 1y58nquamett War Cinglan 9 bae priced frm $250900; the 1013qanrefl Cenlryiprkedfrnm$264910; and&r$1605qarelbribl ipmicmdhm$249900 Sle cr ierhnnarefrmlumbn6pm daily Fe mr inhrma4n abut Leningtun Farl callsdt2595505 nr viibrewwleingtcldcaga Ten mdel are upe twillw Place a Cmmunity f SS twuhme i Wheeling al deaelapndhyhenigtahme Willw Flare llera twa flr ptnmngigiuuieelmm 1558 lllyqnameleellhabnmehunm riced teem $259006 $289550 The lhrembnry Nn lendel MOpUlnna OR O» ahued Wngl n Slankle ffer aeeftnp pleg hneebee Una anteone are aflered an anedaenleln f 30»tn 6Od aleleg lme nme nbandard with hrem bedrm 2½ bnlh and b bebed wur garage "Sme 01 ur bayer bebed al vwnhmen i ihm ily but when key cmparin hpped blmy realiuedwillwylacr ller the ame thilicated luchm ht ata lmclin f he price" Beach aid "Pram nlinlen leel ppli nce and brunled nickel ligblingfinleelinebnlcmilig and lnuarin mater bath hene hmehavr itall" The S5SequrefnlChrl nt mdel i hae priced frm $J9505adhaapmvmapyulr will mny Orallime buyer Thr Hickry at 2150 quare feel i a end unit that leulare a ide etrnenaadwllyingleleel living und priced frm $205500 Fe mre inlewalin abut Willw Place call 047818 0805 minilmwwleigb000hii?old Orchard Wd i Shnkim ller n llecbiu li new mdel cndminium fr viewing Cmpried flhree i bmr0000mctrd lmea hn cm 00000ity will inclde S6 The l913qefnnt Cnendy pue ut Wntn Pela n D Plan batee u ntbft bal nel Hh natlnel Meg! dinng rin urn a wo i an velaed balae ff fine ald dllat meidencewlmen cmplete "Optima Old Orchard Wd lfemananallpaltcactiuerimanmenl br cndminium cmmunity beae ftkr mu ceptial ameeiliet it affre" naid David Hny wnrdwbn ing arhilecl ad pmenidnt el Optima nc hi dealge und derlpmnnt eempny "With geeenrulnkygamlen Surn eilgwindevfnrceaicaiewn rmcrmaliaul lncihihim end a lnlin cle luee rauprlln and heppg reidenla " $thtar S 1?ì% (/))/j/fl/q ( Tuwttba Rwflwnu U pplan 1lvti SriCtare Sigl Family llavn vailahl tr lwwdial Oalivnry gurdare Fd iew Yearn $299900 Plum lim U1mpur St dali U St509vt High Seirl fi Li000tahmaPririenmnn Dinriht 103 Unta Cnmlar & Mdul Hun tlt4 Opp P LanaRtuqGr000 tlotq52 Opav FidnyWdmeday tar ta tyn U Trru000 by Oppairlwut a41a55t2il TheWaterburyPlacecm rbbrrr Cf 11f R(DGf 11Of BRllUUU" /1uaaeeamyfy zeaeww" e7yf Semny Wbdn per aleulntanbbp nn plana dnigd n udnpb paar tnnllpm hanalru rnnda Ne nnnrn ulbn dnaravi lenladirg u unh pin wlh ap n 3015 nqaumn lent WSfrmthe$22iY NOW frn the $7O Yye?pi dirbn8eme Granbnaa llera la lin wlibann ample 01dm nne abubntnnlly piamn Up 102000 aqanme tn 35 hndrnuva 25 huhn WS frm the 8250 NOW fram the $90 C M RD C T (847)984467g SON nnatmahpuelaaledl la Wadmth Rd nat nppmnulnnlnlp 3 can rem nh nl enrrnrcn wwwmycmbridgehmecm Opkn bdd lm 0nbbly d ilr da 00 b ill Omg ell alnl k rn nddrii nndl nnn"h ell kaannd nillabllr all n550l ne000nv"r l50noonlvnmamrnnu Plu get up t an $8000 hmebuyer incentive frm the gvernment Own yur wn hme fr abut the ame mnthly payment a yur mnthly rent Flw? With an interet rate frm Ceritex that even lwer than tday hitric lw rate nd that n tp f the up t $8000 firttime hrnebuyer incentive the gvernment will give yu Save mney Start inveting in yur future Hurry in tdayl iew quickmvein hme at unambnala Samurfiath atorndlny 001 t n ns 01 tatal nnn501405 Ele tl0$o00n2nn aennenlza Elid Wan allia ilnga 1nnhuenn rn hn nn 107eu i nn Manha000m nmknlmn prlvun Ouplaan flaw hn lna nnl57aatnl GfllXuCOfl1 lncreaue yur buying pwerwith a lwer iberel ral frm Cled Mllhalan nrmklnn ulvga Trhan tue hn 0750 lnn7aa Mc000rv One Mudnl tpnnl Mrgur 0111 Taanl5000trcw n 0145 Rata 7 Ml500ln Mdul arana nerlval nmma rtnld lel0000n rnna rum hn $150 erly t 1000108 lupna ntl tr litn 0057514510 Slreruw001 Mdal urano Opnelrnb Oraknerlda ln han Oh Sinn 11157145th Olanaw000 Madalflrnnd parbrul glpllef 0510001 Oawentrnm ha $225 le7lalnn wdwauhwal W000aune Neu Madr upn Mlln clt Tnanhna mmm v Olea aaa7en775 Wah lallallunl Mdal tr un Sabr RldO tell rn 100tnrydaplanlvtur $114105 unnnnenell We Julet nnuulatur all 505m midan Ov 2betlO tallyhumnn atmenrtlrz n hn $055 ennllnn Wdr000ll New Ma01 Opn an050alnr Hm tm h lila lla51u4t70 larbllbe ndall n Cudn tw hn $710 5151757022 Yrkaillu ad010l n arnnatrwlhn Øae lie O 50 55505 Yarkill 000001 108 raamhamnatrun 1r 01000 OOMt717553 0 l_clnoa0000nl OOOL uaaooua0n 00Orr 0O 00aa000Un 1000 don la Onl 0 0000 "rn"" 000 roeon : en O1 0 000m r OOO0L050LL5 nrne al 000e errravrrnuu ncumnezlr u0000r0 arn0000010 url rvaaal00000rnwramecmlalahon0 n 0m La un nna " m ra ma m F alum : a u ao

4 PRL 29MY 1 2009 SUNTMES NEWS GROUP NORTHU Tday New Hme* Final tw Etate Hme are avallabte fr mmediat ccupancy at The Reidence f Okt rving Parke lcated n the Old rving Park neghbrhd n the Nrthwet Side f Chicag mmediate ccupancy hme meet immediate need By Karla ngeli Luc SPECL TO SUNTMES NEWS GROUP Many nceinalifetime real etate bargain are available fr the willing t cle a deal quickly Here are everal crnmunitie fr yu t cnider fr that fati immediate mvein The Reidence f Old rving Park Chicag The final tw etate hme are available fr immediate ccupancy at The Reidence f Old rving Park in the Old rving Park neighbrhd n Chicag nrthwet ide The firt hme i the all brick twtry Greenwd mdel n a crner ltat 4000 N Klmar The hme wa previuly priced at $849000 and it include mre than $100000 in intalled upgrade The hme i ealedbid priced at $525000 The ecnd hme i a twtry Elm deign with fv bedrm and 4126 quar&fêet fliving pace: Built n a 63ftwide lt the hme feature tw fireplace Previuly ffered at $869000 mw ha a eal2dbid price at $625000 The decrated mdel hme and ale center i pen at 4000 N Klmar Call 773777 8910; viit wwwcadevelpment crn Cider Grve Huntley Twn & Cuntry Hme i ffering three beautifully decrated mdelhme atit Cider Grve clubhue cmmunity lcated in nrthwet uburban Huntley Thee prfeinally decrated hme are filled with deluxe ptin and hwcae tunning cutrn fixture and finihe giving buyer the chancé t ave ten f thuand f dllar n a nefakind hme The three mdel fr ale are the Smmerfielci Crtland and Granny Smith When cmpleted Cider Give will feature 290 inglefamily hme frm tw different erie in an intinmte etting cle t retail ffering and tprate chl The ale center i lcated at 10284 Hpkin Street near the 90 ntertate and Randall Rad Fr familie lking fr a beautiful inglefamily ranch hme that ffer a tair4ee lifetyle Gertad Bulkier ha a new ranch mdel available fr immediate ccupancy at liberty Trail n McHeny Tówn & Cuntiy Hme ha three wnderfu deciited mdel hme fr &e at cider Gm t ekimiue nelgbbffid lcated n nrth wet uburban Huntley Each f the thee mdah futui deimm ptn and cutm fln4he Shwn here i the Crtland mdel and i pen daily frm 11 am t 6 pm r by appintment Call 8664328717; viit wwwtwnandcuntryhmecm Gergetwn n the River Glen Ellyn Kipling Hme i ffering tunning bargain and many cleut incentive fr everal hme available fr quick delivery at Gergetwn n the River a 48unit maintenancefree cinmunity in wet uburban Glen Ehlyn "Kipling Hme behicve timt every buyerä&differentheed rne need help with a dwn payment me need help with an interetrate buydwn and me jut plan appreciate upgraded appliance" aid Kathy Dame vice preident f Kipling Hme "We are ffering many tier f pecial bargain and builder incentive in an a la carte fahin t meet the need f ur buyer" Gergetwn n the River i cnveniently lcated ff ntertate 355 near Nrthvenue and Swift Rad Call the Kathy Dame Team frm REMX Jliet at 8157415082 r 815693 8336 rviitwwwkipllnghme crn Liberty Trail McHeny Fr familie lking fr a beautiful inglefamily ranch hme that ffer a tairfree lifetyle Gertad Builder ha a new ranch mdel ready fr immediate ccupancy at Liberty Trail in McHenry The 1888 quareft Lexingtn ranch hme i a new architecturally ignificant mdel within the midpriced cmmunity Bae priced at $263990 thi paciu threebedrm twbath hme with crner lkut baement and numeru upgrade wuld nrmally be priced at $329250 but i priced at $289990 NeecPtPltigerhme ite?" Crne view variu ranch and twtry plan bae priced frm $241990 to $323990 Liberty Trail ale center i lcated n Lincln Rad apprximately i mile wet f Chapel Hill Rad and nrth frute 120 Mdel are pen even day a week Call 8153854495; viit wwwgertadbuildercm Lake Ridge Twnhme Mundelein Lake Ridge Twnhme a new cmmunity ffering cutmized flr plan recently pened it firt fully furnihed mdel in Mundelein and i nw ffering hme fr 30day dclivcry The twandahalftry hme prvide 1600 t 2000 quare feet f luxuriu living pace Fr a limited time buyer lking t weeten the deal n the purchae fa tw threer furbedrm Lake Ridge iì!e fli eg (!t 1) Çi iìjj tli f»31 f i Fr the firt time prpective buyer have the pprtunity t walk thrugh a fully finihed twhme and get a feel fr the type tyle and quality f hme available at Lake Ridge Twnhme twnhme can receive $40000 wrth f upgrade Upgrade include multilevel crwn mlding tainle teel appliance hardwd taircae and mre Lake Ridge Twnhine i n Rute 45 nrth f Rute 60 and three mile wet f 94 The decrated mdel i pen n weekend frm Nn t 5 pm r by appintment Call Jeff Ohm f Premier Realty Grup at 8472349800; viit www newlakeridgecm Mdel FROM PGE 3 enjy an exciting lifetyle alng with their carefree new hme" "We like t hwcae new mdel n a cntinuing bai t demntrate t viitr the many different flr plan price view and interir finihe that are available t buyer" aid ndy Zajac vice preident f ale and marketing "Five f the furnihed mdel are in Maple Twer with ne mdel in Elm Twer and ne twaml threebedrm deign are featured nd with price tarting at $255000 and incentive n cnd fr 60day cling Optima Okh Orchard Wd i affrdable enugh fr firttime buyer a well a the deiring penthue auch extralarge cmbinalin unit up l 3000 quare feet" Call 8475834700 fr vice mail at any time r viit wwwptinmwebcm ;i: REGULRLY $30900 FNNCNG LBLE FOR MOST CREDT HSTORE 3 BEDROO1 2 BTH PER MONTH TOTL WTH STE FEE ND FST YER OF NSURNCE NCLUDED :l; FSHNG K \ t F 1) \ ROrNG \; lktn( 1Hl\SWMMNG *MOE n TODY FOR LESS THN $2000 LL QULFED BUYERS CONSDERED j 4P STOP N TODY! 36455 N1 Sheridan Rd Beach Park L 60087 84733641 O wwwzemanhmecm ZHKlngWayzemanmhccm nic ite fn)n $ 20000 Hme/lt )LCkgCS (miii $365000$ 2 iiìlllin!t()dts O/KlS S(t & Sii?WWl4/)111 O? bj appt Gra Lake Rd n rziralitlcb l il:ifljle 1?l t /ic S1)OrLS ttf UijJ iku wwwnewprteveciu r call 8477262727 Niav nuucn i NC

Tday New Hme NORTH0 SUNTMES NEWS GROUP PRL 29MY 1 2009 Chicag mutieve twnhme hwcae ivabiity privacy Tday S)aCiOlS rnnti1cve newcntructin wnlwrne are a ntch abve cndminium living and many include a vate landcapc( envirnment withut the wrry f mainte nance huing expert ay fl(1 twnhme ranging frm claic rwhme t du 1)extyc reidence nw are a ppular huing chice in the Chicag arca fr cntry4evel buyer firttime nvep purchaer anti emptyneter New twnhme (lccl)ed in Chicag in 2009 are much mre luxuriu with iaciu pen living area and highend finihe and amenitie They al give buyer a nice frnt yard deck balcny r pati pace a garage anti fftrcet guet parking Develper Steven Frytz f nchr General ay there are many rean why cnd dweller huld cnider upgrading their lifetyle t a higher level with twuhme living One fthe bet attribute f a twnhmc i there i mre privacy N ne live abve r belw yu" aid Frytz wh i develping Crnelia Curt an awardwinning 63unit twnhme develpment at 3001 W Crnellave in Chicag Wet Rce illage neighbrhd When cmplete Crnelia Curt will feature 13 building with tw t even threetry and furtry twnhme per building Flue ixtinit firt phae fcrnelia Curt i ld ut and ccupied Phae al i nearly ld ut with ne unit priced at $425900 available fr immediate ccupancy The $28millin Crnelia Curt develpment include twbedrmpluden threebedrm anti furbedrm twnhme with twandahalf t threeandahalf bath and 2242 t 2904 quare feet f living pace Phae 111 bae price range frm $499900 t $644900 Frytz currently i ffering ix free mnthly hmelan payment fr mrtgage princi Pal anti iflprqtì p cah value f $15000 talified buyer n Phae E$f Cnc1ia Curt Frytz utlined everal f the key advantage f twnhme living when cmpared with reiding in a cndminium: u Privacy "Twnhnìc are the next bet thing t wning a hue" Frytz aid "Like inglefamily hme the twnhme at Crnelia Curt have a private ecured entrance anti a private deck and yard pace" "Twnhunc typically have mre quare ftage than cnd and they have the luxury f an attached twcar garage" Frytz aid Mre Green pace Many twnhnie develpment ffer a buclic etting Twahme at Crnelia Curt verlk a / L The twnhme at Cmella Curt feature fee imple wnerhip with a hmewner a!clatln tnicture t prvide grund maintenance Mnthly aement are prjected t range frm $85 t $115 and nclude cmmnarea expenep uch a cmmn nurance landcaping nw remval and water and cavanger ervice rplcaly cndminium aement are three time a expenive a a twnhme new 10650quareft private parknctled within the 24acre develpment The entire perimeter f the prperty i dtted with mature tree and luhly landcaped private frnt yard nchr General i planting additinal maple and ak tree in the wded areathe 1acre perimeter green pace which erve a a dg park fr Crnelia Curt urrund the eatem and uthern brder f develpment u Quality cntructin Crnelia Curt hwcae ldchi craftmanhip i ajity cntructin Fry ::: real balute? Mn the taircae lt nt a prefabricated hrtcut that many develper take t cut ct" a Higher level f detail Gldtick aid Crnelia Curt feature paciu interir with a multitude f tandard highend detailing ranging frm upgraded tainleteel appliance and urface uch a granite marble and limetne Slid appreciatin Fr buyer lking fr a gd apprecia (in n their invetment twnhine generally have a better appreciatin than cndminium becaue deign and cntructin detail ften are a tep abve Frytz aid new prfeinally dec rated and furnihed 3try mdel twnhme recently grand pened frviewing at the Park Hme fcrnelia Curt a new 12unittwnhme phae aid Gale Gldtick f Cldwell Banker Reidential Brkerage The twnhme at Crnelia Curt feature "fee imple" wnerhip with a hmewner aciatin tructure t prvide grund maintenance Mnthly aement are prjected t range frm $86 t $112 and inelude cmmnarea expene uah a cmmnintance lanficaping nwremval wateravd cavenger erxiçç Theale centeitlcatedat 3007 W Crnelia i pen Theday frm i t 4 pm and n Saturday and Sunday frm nn t 5 pm Fr mre infrmatin pleae call 7734788414 r take a virtual tur at wwwcrneliacurtcm Fletcher Rw nther urban twnhme chice i Fletcher Rw a 20 unit twnhme in Wet Rce illage The develpment teature a landcaping plan hwcaing tree buhe and ther greenery all year with flwer in the pring and ummer The land plan call fr tw cluter f 10 twnhme eparated by a landcaped curt yard aid cdevelper Rby Frankel partner in Bluetne Develpment Bluetne Develpment currently i ffering eller financing with a clwn payment a little a 10 percent and interet rate a lw a 499 percent n jumb lan at Fletcher Rw n additin buyer will receive ix mnthfree mrtgage principal and interet payment an incentive valued at $10000 prfeinally decrated and furnihed mdel twithme gj i pen fr viewing at Fletcher Rw The mtlel i amng a grup f 10 twnhme nw nearing cmpletin in Phae at theinnvative develpment Fletcher Rw ha three ant furbedrm unit with three r 3½ bath and 2179 t 3044 quare feet fliving area Bae price range frm $499900 t S749900Tw twnhme have been ld and clet! and the remaining eight Phae unit are available fr ccupancy within 60 clay ti 1 ) nh Oakwd Shre Three rwhme and fr twnhme currently are available fr immediate ccupancy at Oakwd Shre a 94acre mixedncme cmmunity in Nrth Kenwd n Chicag MidSuth Site lakefrnt Oakwd Shre will eventually encmpa 3000 new hme and rental apartment flue cmmunity develped ly Granite )cvclpment The Cmmunity Builder MB Real Etate and UjMenture i being built alng Oakwd Bulevard (39th Street) between Lake Park venue and Martin Luther Çing Buleyard pecial $ 15000 City f Chicag dwnpayment aitance grant i available at Oakwd Shre between nw and pril 29 accrding t cdevelper Je William preident f Granite Develpment Here are detail n the rw hme and twnhme nw available fr immediate ccupancy at Oakwd Shre: u Rwhme Three available rwhtne feature three t five bedrm 2½ t 3½ bath a family rm and 2827 t 3500 quare feetflivingarea tart ng at $529900 Twnhme Fur twtry twnhme are available fr quick mvein They feature three bedrm 2½ bath a family rm and 1995 t 2044 qi tare feet fliving area Twnhme price tart at $374900 The Oakwd Shre ale center i lcated at 3744 S Cttage Grve i pen by appintment nly Call Mnica Hernandez at 7735380001 t chedule an appntment r viit wwwakwdhrechicagcm (J l liii )ì "rit ( ;ri 4? 1 The Fletcher Rw ale cen 1er lcated at 2424W Fletcher i pen n Saturday and Sunclay frm nn t 5 pm and by appintment Fr mre rnfrnialin r t make an appinte nient call 7732816600 r viit wwwfletcherrwcm CT1ON UCTON SERCES QROUR NC Etithlllwd 19 June 4 2009 BNK DRECTED New Luxury Hme Cnd & Etate Hmeite a a HGHLNDPÁK 10700 SF Nrth Shre Etate Near Lake Michigan 1098 Sheridan Rd Hlhiand Park L Originally Priced t $3195000 ENSTON Luxury Cnd 2935 Cntrai St Evantn L Originally Priced t $349000 t kp : 1 i t 12 rm 5 bedrm 6Y bath etate hm Gurmet Kitchen with many upgrade Decrativ tn til & cherry wd thrughut Lavih mater pa 4 Freplace French Prvincal with dramatic tw try fyer! 15000 SF Hbn Rad Etate 26 rm 5 bcdrrn 5 tall & 5z bath etate n 25 cre ll level acceible by elevatr garage 5 Freplace; 4+ car Fully ntegrated Smart Hue Technlgy Guet uite theater titne wrn with auna & team Wine Cellar with tating rm 0S061 ndiana ve Naprvitl L Originally Priced t $5500000 Hre allwed Large 2 bedrm 2 bath unit Spaciu flr plan: 15311580 Sq Ft Gurmet kitchen with upgrade New Slid manry cntructin with architecturat detail Heated ndr parking; Privat balcnie; Elevatr Walk t hp chl & tranprtatn WOODSTÒCt< 3 Sanctuary f Bull alley Hmeite The Sanctuary f Butt alley i an excluiv 200acre envirnmentally prgreive develpment near the City f Wdtck lut 50 mlle frm Chicag Every apect f the 105 hmeite develpment thughtfutly planned arund the natural feature with twering ak & hickty fret and avannah Hm alue t the Upper $1000000B Ori9inatly Priced t the mid 8100000 cre i acre hmeite Excellent Wdtck chl City wer & water Cnveniently tcatd near hpping & cmmuter train il e e t ti : ;: lt i M 1t CLL OR EML FÓR BÑÖCURE WTH OPEN HOUSE SCHEDULE Benj E Sherman & Sn 8473742710 chrir@agauctncm L Licene #4440000177

iç 6PRL 29MY 12009 SUNTMES NEWS GROUP nmj Tday New Hme Tday New Hme 909190 SOlTMES NEWS GROUP SPOL 29M 1 2009 7 Pin tnti $50nntt Ctiatwr PONt drnitannt ril fr dx ndminlnl bailding t b ghtnd n winding tnd npd rd nrlahing lgtanp atan nd btk ltatnwr d tw pnd Cantntln n ti itnhttrt thn f Clnic twnr Pint druhptnwnt nentganptth and rudy tri dit aap000y Suburban hme cnd chice ffered fr quick pring mvein With the firt day f pring ca hïghlighi ihm laient bleben jt arund the crner and the deign rrd in ba xbucba hme hunting ean fficially Chnicaglnnd cndminium maehelplace e aid ander way qualified Chicag hme huyera wh arc wiiiixg ta "Thr mdel are qile imprenine hvwvaig hr nletiin cle adral qaichlyand mve i nw will find un abndance f tenr deign ccepl" aid nceinalifctimr deal fr tire Campbell "The mnt anlablr purchae f cndminium mndeliihecppcewhich feubreva nctagauihaped dining twnhme and inglefamily hme that are redp fr immediate ccupancy real etate ex ecyprriaaawrdwirrning twbedrm iwnbath peri any Chicag acea develper arr ilneplanvilb t654quare feel plling ut nil ihr lp ta liquidate immediateccupancy rrled ilnr plan diplay a large ufliving pace The unique tue trame inventry Hwrvrr pu ape fvvrpla wilh a dramahic muni hace dwn payment cah dining mnm with flrtncnilig jb eccity gndnccrhilncer windvw and nccela a nearby and br able l qualifyluc amrgage cnnumec advcate nay The Paiefieid i auefnciealty balcny tfyna are trpping fc a peepeinghiagdaalirciteenneth rlaattaonre nhedrmud deigned t126quareivi plan! wet uburb umr nf the bat 1½ bulb l ba va impreive nccap r y;; include dmvmilrmiiii lache L nend elped el a fully appinted u kitchen mith peuiula iland nd a paciu living/diving evm wilh acce u a balcny Pin Faiefield flr pn are lucaled un flue ecnnd brgh furth flur The Painheld i priced tram $221900 The Emeexn ia twbedenvmpludealwabathdmnign lealure 1290 aquaee feet f living pacr Lacaled vn the ecnd braugh furth finra ThêTmemaav i priced frm $209900 byr Feancaah&ncidte i nnribwnluburbandepiair nd Palatir "R Peancah and neinlen ufferanariety f aceti deigned humen that il all tate level and we are ffering limited m incentiven at ali clue develpmeuf" Kahn Cumpheli alm manager fe R Feanceuk thnciale "Sightnwbuyencn lahr advantage f everal pecial limited iimricrtinriferndctaeuding n their individual eed" Thee miglutinclude apear nf paid aenmet elhuadn f dllar in upgrade including wd lnn und premiaa appliavec pachage vr ann bilder pid clning cai vi The Seriluge ufpalarinrthrslmlfned ut PalaliarnandlbeWatnrfrdCudvminìum in Dra Plaine aid Campbell Here re wn f hn nubacban cmmniiiex: Nrthwet brla deal The Henilage f Pallinr in new 48unit luxury cnndminium drvelapmmnt alto Snulb GreclepStcertïdwlwyal eealdecealedmudnleeidece are nw pr fr viewing atibe devrlpmmnt und rmeal hme are available frinurnediale uccpancy Thn aurbedvm twbedrm and tvnbedcwpluxden cndminium range in ian imm 1126 i l7l0uquacalreti liciag pace Thr Ural renidenl liane already mved ita their new hme arid price range fcm$22t6001$310005 The }henilagr ni Palaiinr mdmn Cppr line pian att matar bumant ba loti ub digd dtahe whlh pn t tie larme grat rm tie pdd frm $339900 The tanna nrdl atth Wtntnrd ffr 1545 atur ft f tng apag and Ot pdd at RnbrOkttwntwmful 9k ahngl4mlp twa tttut 9 nlntin T cnlyrd twnlwm han WO t tne hd000mntthrubth 4 nnwd attaghdtnnir 04 trir garg umalecenierialactrdat7gy Geaceld ve in De Plainea Fur mare infaraxailn call 847 2976769 rviait wwfeancuah Wat $11101190 del t Ciugktamer l aiuie a arm 108unii lunacy cndminium drrelpmrnt in wel aharba Cniryide The Canneely Grvup a highlighting taue pàviv mdel rmnidrce n Witlw Spring Saud a quarrer mile nrlb fjvhinirvad "The ravhtple reirtnace at Clachtmer Pinte arm peaifivalty deigned far prfelnl bxine executive and emptyetee buyer why are aellingu large inglyfamily hymn in hm Wat enuheb a dpyrmrh big lvve thbligaingle level cundaminiam aid lyx llpdiltcd Peaperlieheniicluive ale yd marhehing agent tve Cichtwec Palte LLC b pefeniunallyiueihed and drcmlnd mvdml candandimu p1u faca unafurnihmd madelincludmgadrluepenthvunb are vumpimtrd and au diplay i thefieal6tuvyelevalvrbuilding erecled al tie 64aven Clcklawer Pinte deaelnpmeat The drnelnpmmnt hwcae lwabedmvmvetheeebedmvvm levybalk reidence with 1882 f the termlined hulerard hitchr wilh ealhvpeainulaia ta l9y2quaemiemlfliaingeea lanci and impreaivegreatevam cenieriavpmadailpienm loum cauduminium building Price We hace hevaghlcilyliving unlluaeatwalhmaghfivn 011km with accculvlhrbalcany TnOpmandlcahedat5Suuhh fr ihm emmaining unit euge lthmaubuebuwithlhrxrwmd building Bane price av theuè TheDevaniautaaheddbOm GreelnySlemel Parmre infe rm $289900la$349800 elwhichhumcaam aleeklnlrri eenidecemygefmam$449910 pluden lvvnbalh dmïga Sea mahin r a ivan ni ihn mvdml The Levav mdel which i vrwithhurhednmhaxsinhe la $464600 arma 1512 uquarm fertnliijng ca18477096l38eplmarvinik lcuale heel and reemble upgeadyd niainleaaleml appli The tw lvpflvne penthvflc apace Lacaled au hr aerbd cvcieaculcnm nrbanllteenidmce mardawa aveuand xpmflvrpla wilh cvdamiiuma mataarm Pca ve heugl barili ilvrathe Pmncaah al hn anlyihecv ram Chicag with luxury tin 10fl aaeig ceiling that three bmdevm and 2179 lv Dmuvv ix priund Pram $309600 ileeminivgallheiralfnmd ihn nach a deigneewave erahe cilylplm lll icing" ire 2207 qaamefeetilivigapacr Thixmplllbedmamplanfealaeex OfPaluhiue u ppular emcan ceiling Piulare with malching aid pluxpaviuleceacenthmpenldmumuficmuleyfnymevitbvinwx aheuciiacundvndviumdevelp pedani lighin nvr the hitchen "Our urban hilaba al lea hue aeedcnigxedfr eulam f hm treelived bulevard ment netled rar duwalwn iiand ad an upen living area tueca leeh cabineley acceled buildal and are expected tu blieben wih eatinprinlni rlhwml ubarban Palatic mid Macian Cuela alen xm with bruhed nichel hardware eangrin prier lem $70000010 landandimprexainm25faatgreat vailable feimmedialely c 0gev at lire dcvelapmet The aadpvvdanllighlingnumpeded $725000ahm000mplelmd rammilhaccenlvlhmbalevvy cupavcpi lre Dururt wbed Lrx mdel vitre 1545 aver niane nunleelp" he ageaadapeiagincelive anffivmdlauvdayaream rm lwbaih rexidncen wïlh amefmetvfliaiugapaceaadil aid pele ba hnmr l4l4qunamimlallïeimgxpace peicad at$289900 The Wulmeived Cndmini Tuex la SUBURBN 7 TbmCarllnnihvbmdram Theplnfraiamcalaegeldlchr twbulb mdel wilh mre than nd ruling area awell an afar 1014 quare teetufliuixgpnce mal dialg rvam 1h51 pen t fealuema au pen lyaimitb u lheliiagrvvmthmdnrmldlailand in iluehilcheu d even a play a at000ing ulhmr view mindvwnuerlhehilchen mb irum ihr filth flur Ove vilhelargeat reidence Thehumralufeaiueenapfitin hm baildiug the Carlna bcdmamllaeplufmmaimum baal a traliam dimig evm privacy axd may laxuep np livingrm ape la hebalcny grade incladig mh cheery amaxplïtbedeaamvndmalee mavd000riaginihehilchnnamd balia wilh u tll wall f blli liaingaemaaavdupgcadedgeaalinex cbiarley The Celluv i ile c000ire lp and cabixciry peicadiram $329900 The mater bedevam i 17 feel ThefileeilagrlPvlalixxlr wideacvlraiaegmcvalhinclva el nd full bath milk a malhi /» hawecthegumtbalhiapelvule r i lllir d y dhed mnd m Jtyin i li away i priralr hallway The Darnehipniced al$294900 The Slellard al Pialiam la liedaay a brami nw lne afqalaiylaalt gnnnly cldex 32 cdmiulum ller ppulteat tataey and rad hamm crafted lay KLM Bajldr geighlddlmhimbedeam Savi raptianlly pelard ecidrr ialdn a ftall barmnne wbalh tlr plana The ce qaetncaar mn lntra hed hmnitn ally nwr rd maer maiurflgrrruraugemmaeeanv ad mae anidr than w anald pnibly lit lg upacc Priven range frm $264900 l $336900 The Olmfund vi Palviine alma ceulme in al 190 Wex Jhnn Sired Pvr mre infarmahiv cull 847700 6238 r viit wwwrfrancaah nflen Plme hrem are Ove avila cemalaig uf The Waler : ledsrarrcvahvluxry 110il Why rent whenyücan wn a KLM Hme frm18999o Che a brand new inglefamily 2try r ranch hme 11mm $189990 nw at SunetRidge Etage in Richnnni /i dawn puryniant anal 30year fixed mòttgabe at 3991 KLN3ugrDLmEl3 81578418 a&uv (url" wwwklmbuildceiinc Opa 106 WdFai laland M S llana) 116 wnkad anby aypmiaraaaa 715 Pu 10 thud ildinuhra ma ear um ilta u iv l7v ramlao2 uil ru hxrva an rh dab hudidn 4thaknnWWift4a/0 By Mamy Marre apnclnlra uunlya veux mor prelian in tre new evanamle aiiwlanpegenm ham eligiblcfirlhimehmebyaea lau credit up t $8000 va the pumbane and glaring al a new hatncbyflecembeel2009tlmr ceedili ve individual wilh an incamm ander $75000 r far macrind caapin Wilh acame dme $150000 wh film heir tavenjinily and in belched if ke bpeeella the hme wilhin themmymar Camptelcdelnilvn hn lax credit re availblr at mevemrfvdeealhvingianceedil C Tax credit make nw the perfect time fr firttime hmebuyer wa&caunlrylomm l faring the lawexi peicmn i year wilh ivvvhnmna nning at $149990 rmd ainglefamily hamm beginning al $199995 lm and Cnip i va vilmeing cnmmanitppecific incentive prgram financig aller thrugh K Hvnaniaxmeeica Maelgagm plu a mvelgagm paymel peahechi pn hat help ib hmmmrr lane hmir jb lbau&cntryharighimm : Suburban h ml PROM PGE 6 lia umt financing thrugh Standard Bah & Tval Ca huard in Sich myisill Far mare ialvrmlinn call 6303530704 vrvixihwmwcu &udeaelpmenlcm Saulhwetbnnban deal Sbplinglbameinhelpivgbuyre $el fithe rental nnadmihi and :il wner hip aba em cartdviaium alímbm Dab a rigli behcvdaillonewcnulecü bnichcudnmiaium und valid fledlwahume vlhe fur meal ide iaulhmcl uburban Jarutralinn (FH) maelgagv pmfimamilimevagh cuber Naliuval CityrWrlin Fueg Hme Marl Sge hm excluin cadmex lar ThabmOvbuaaidKathyDamex vive peenidet b Kipling Hme iledmcelpee "Thi ayerini garrrmenlinnnved lav pmgram 4lluw fe hn dama pynmel la bevavered aadqualified buyer vid have av dvrpaymvxl l i a bandailrd prgram ilrmmrghihecilyvijvliellhccav help a qahifimd hpee pecimaa with nmveydawn t that rnihie limrvghaui ChicaglaarkkiberpkalenlnWcnd; OalalleihPeuimiminMclimry; The Thmne nl Rcmivgia Pinte laat; Chrchill Club Slarplechanmand HuntClhin 05mw a; Prvimience in Elgin; vit Cl er blruvminllnfcy Cvupledwilh ur inceedibly law hae priven alleavlice mcmfian prgrarx and acena l wide range fmrtgaga flaxelag thrugh vue van lenrier buyen wh have been rvaaderixg miren in mhr a pmhrae hauld mahe their mnvv yaw aid Brian Murphy vivepemidrl v machaling inrthwn & Cnuiey Rame ll Tam and Cvutey anma ventee ne pen daily lem 11 umiapm arbyappinlmeml Pr mace ininanahian milwww lwvaadvvaulephvmeavm vvnedig t Cmrtad Buildera hm lamet 30paar lined melgage ete ja he pat 52 penen cmbiued wilh llar $8000 federal tau reiad d 5mw hme privad al level lah ena in 2003 mare 1h15 hm flnnneial appartunihy ab a lifalime te fientlime hamebuyce "Thiirnalyagemapeugrm lealttypnlbupemnwilhbnv laimly nu mavey dwn braugh Jahirl ntin d Pegeam t5ratgeania5arì 75flmcvvary Tcrce05y6et and Kpimag Hme paya cling ram upl$3000" he aid The awaedwinnivg cvvdamiixm ad vrlyned hymen nl Timber Dab re ave flhe da nelaprrxmvlnucvexxlulnelling flar plx afleciug weldanigned fur plan lyalu al aifrdable prive The altravtive brich vaadaminium baildiagfmaivne gabled mi rmcmnrd blvanie cayneed puliva and eevad f nr a deck Cadmiim hme plan raage iv ite brvm 807 lv 1209 aquurmlemhwihh ar O w bedramxand nvevrlmhalhvthe cnndvmixivm range irm $124900t$159900 Theyrvgn iv viaelrm 1115 ta ff04 quare beef al living upce and are priced iram $169900 la $230900 Lcated neue Pratage and Mcflnvgh mud ihm ceidencen attimbre Oaha clive ivavvlive inlerir layut a welt a evcepliaalexleeivracvenl "Timber Ouhu alice hymn huperalhehmlabhalhwueld n lilmalyle vmmanilywith hr lcal aechileclural acaevl i 1m MODEL NOW OPEN! OPEN BOUSE STURDY ND SUNDY 22 PM 4PM 1461 SHLNDRSUR ENSTON L Hme Peayngilve hmebayer cauldxtmih far heller financil envirnment l buy ihele fleh hanre" aid Bgen Cerhd acndgrueeutiaupeenídevlaud CEO al Geeind Builder li bayera lamb ai hr hme me vler nl Tre Trail al Damn Creek lirnywill nhive that ur peicinghadenpped l ihm leva w Were elling hame havh n 2003 Thipvrleelnlrr ha reiled in ne abihm bent mamutmeat upparivuitim in a lile6mm" "Wih mnrlgage avina al hilyrically lw nahe eam 475 pee cmatfarn 30yearfinmd calcinan il nw mvrm alfamdabla fr a family la huy ne ab ar inglefamilyhme ah Sawmn Cremb hen l rent a typical mahedmam apunimeal" aid tvbydv Canhmivivmpreidmnlafmnrhahlag Plu manybellece that the hanig mamhel ha labiliamd and will cyme bach with a ven geauve in ahvrt me" Fur addiliunul inbemaduva Dawa Ceach axd Gmrtad Builder viit wwwgnratdbuildercam r vnl 811547 0800 ditinct mltiumily peaduch linea" aid Damn "lhhaugh lbaruiably peiced the vanduminiam nd 050mb ypeçlharvealmalarrwnitihvaght unavrplntayvalmhjchmay imime liviag pace" he unidt" "The linlenideuha haca already mavema blhme enveptial hme altimber Oah bachp lgreen pace and mendvwvila a val mn grve h aging aula and pinn tree a mmli x Sdabferivgrmuidmlncaaiv view lim aid Gvhivullrainl mh live ai flmbmroahmmlahavca chaice abmce than hrem Salic Parh Dilriel pablic 18hla cure inviding lwvad Wedgawnd and Wdrli Reduced rten ame aaailablm lejlirl Parb Sinleíclmembrr TriilTimbartyab lahm ntenable 55 in llini 52 (helfervn Scari) ad head rai The vvmmaily i lcahmd xuulh va yratage Rad near McDavagh Ovad iawnahjvlicl Par muev i000rmalin hal Timber Dahu call hn Kulby Dumenlem beam SeMnlvliel a181574l5082r8156930336 inilwmvvvhipliyglmvmmcym Fr mre hvmnbyiagifewah viil Deflat Mrdia Seevien Wnb aile nvmauvdmbahmndia Tday mrtgage crii a replay f the candalridden 1970 lay aggrenire $lhehillaneffarihplkm Thnk Pmdvral Rvnmrre Bned l pank hmmln ininrei raba lmee alhivhnhinamd merica appear n he weuiheriag ihm Well Stemmt hailvl and diva candilinalihn 519 ecuvmy The hmercllnacm manirel ihtimeihan apill and mnt gage rule n he mid4pervenl nnge nd ihr $8000 Ovallime prvbraenhaaeredliinlaehlag lvlmrembuyeelxlanbuddhng peighvnhngmrhel Hvwmvcrvve nllbihae t deal nllh the ailmacmpmaiag geeedlhalgvthhmnam lxiv the nbpnlmmmvehgmgmdeba ele which veule nayrrally nburiedhachia 1999 uliv Pannie Mac Cn hega eaing ihre cmediierqimemmlu lan l yveclraad fmm banhn uadlherlevderala amnvr deignedlahmlpiveeaae hammawaremirip amng mimarilic and lvwincamevaumee Thdny nn ab llraaand ni hirram van arm hradnd lla baeeclaarrvnhivmidnhmcaa madveairincnmrbamrvween vaaniulbrdhayaythe evalaiimginlmemlckargmn ad van ntrefianemhncaaxehmr alue arm nt appmeiatig ll lai mcevt mperlecv emmain indicate thai eeeryam mydream abut thmanrdva 3eeamafhmeavvnerhiphuh nul everyvam ka hm ceedil weehncvmm andjab evanity la ivpacmthr threhld ala nevrhnmn Unlnetunatalytha envvui nahprime ma wa h mlmdbyeuaymmhgagn deal 1h51 na une culd enfue With thai mmmd il i urpniningthahaneeemlaeecalhhhngeeailjs Deparbml abhauingadljnbnnlmevmlapmeni HJD andlablha S70adthnlidalwave nipedmeal tauning dmiitealivinured PH/ul laana that mahadhhnaaghblighlnd nmighbrhundinfhivagaad themmiarus cihiehahnmr i: dmama$fpfllyayyner Dn DeBat ON TtE tome FRONT hqv "The PS candal at BUD wa abaul lrgal and pmclaehaepmfil; abvulcuryplimaa mecrygvmenmenllevelwrnie aufimam und frmer Chicag SuTime rmpvelerfleiar 0 Spaerlhi 9l3bak "Cide Deheayrd Par Cak hlhalllmnmliv neigh bnehadcmmunilyaclivih GailCineliabahiledblebbl ing and panic peddling in Chivaga and maa pillnd againal rear flran300hlyhynighireal lpvmpaale and naxcrpalau mdgga benheen wha anedlhe lure vimayhuabbamn Seehian 325 vm 238 PS mrigvgnmvdaiedhphhe Hauixgct b 1969 bara dming Pveaidmnt Lyndn Jhnn "Gmat Savmmly" Sachim hhmeaelyl970a hre vlpmamhgageabeingmnde in the bne clp were PS b Cinvalia aid The really agmvh mere evndngivad axing PHn mauve peaplafeamaldghnhlaa talhcrrwghettwlralwaaw waawhaie ecvnamiclhtngamatiiheaempieacy Sme pmplewmem maldgahellaba lnlnfmnnphlthaeadah change aidcixcaitaia Bay er hk The fient alep i when the havhandthe aving and lan rebucha give mrtgage anlaaberchabilinahi mxd empaira hlrehmen Ciuvhha aidthe ecnd hep i when &mapevlahamvameiha panicpeddle Spevubahaewaaldbuya hymn mr $7500 rum a whila bawdy and much it ha a black gftqihï1igm$l450snvng9paju 8479844855 a w w il man middind wilh building eedeniailinnn Cixella ld nd ihn penplm mba bavgkl hm hvvn wvemnpanrlheyevuld nnhgelvanvrnliaabonnncing vlhmpgaiappraved brpit ammiih minimal dwn paymania vnmm6mmn a nw $305 Cngrm had every gad intaxthawhnn haypurned ihn Hcuuiegcl b 1908 Jahn Waerhnudllhe PSS Chicag viftcmi the ll7flthey mmauhwmhi btihe FHwnrvt gearad rrpfarilad tlrry xhnaldhnaetaaghhlhnbmryee abulvabam" mm l999pannle Man anin which began a n pilt prageam iniliahed byline Clininndmiaileatin inviyed2dlranhhm lhaunlngmarhelnaivnwidcllmyprageam mncaurngnd lander lu euled hame mrgage l individual whve cmdiiwngmaenmllp vl gad enuh haquiibpiaravae By2094 Cangeen demand edthatpanim Manheip inne ware lan ha lwhuvme barcnver Levdeewnrelheenlcuigtaelhlandirrchlyta Wail Slrmehanlennthe nganiahian bughln bigger lice b bmir dakicahlaann Panie Man campond and mperl ay thaldecinbaavarlpdeulrvymdlhe cmpnyavdthmhrvadl rleag lawn lne huing manhel and lheev000mybrvaamitin mduend arah fainky nab prime lan v hn marheiplace Saiinadtiàva all avec again The lav Fnn Dar Sn Sal waekby mn ate bumr yndlaled by SaBt Medi Serul un raun hn mpleniilnn nl ham baying mrhlagn hpping hnmuunnnhlp rdung building menanlla avd mmadlimfi Fam ma hmbuylng mamenlan dalli Wnb ail al wulf$ng$e mir mi 45 a efed f! Fina$>i hme thai fil yur ifeatynavd yaar bdgeil With ihm lainai energyefficini feulyrex a 2½ car garage and a flly anddnd hmaxiin yaad napecl ha pay far marn 44U"W! 4&g c)ap pa5 a54 kelpou1rn WOOS pt dully fodnyuplebl 126 n CalvWkilhlnllalanfl l CShhD$E OM$S hltllblal Oln l4blrx; tuaht mnlla )flfioj9 Srtl 65h10 hal8 nll mlnclynlramnlh /firr aemya mmtamr

PRH 2944Y 1 2009 SUNTMES NEWS GROUP NORftU Tday NOW Hme = Grgeu ïn Rger ii l O a k Up t $69000 belw builder Ct!!! 2 0 (304 PR)* 30 year fixed with 25% dwn! nteret fr 12 mnth! 399% 30 year fixed (406% PR)* With 20% dwn! nteret fr 6 mnths! 424% (431% PR)* Blended Rate WithlO% dwn! 441% (448% PR)* Blended Rate with 5% dwn! 499% (509 PR)* with O Dwn! Ye 100% Financing! OPEN HOUSÉTHS WEEKEND WEEKENDS: 10:00M 6:00PM ON DYS :WEDNEDYS 4OOPM 8:00PM CLL TO EPJPYOUR PR1kESHOWN& (86e)71 51358 Unit 201 Own thi grgeu cnd with granite cunter tp hardwd flr and beautiful fireplace fr $30045 belw the builder ct! With ur pecial financing yur mnthly payment can be a lwa $1 027!* Mnthly payment include etimated prperty taxe and cnd aement! Pratt Blvd Clumbia ve Clumba y w Nrth Shre 1&5 629 Wt rh Thf Chrcjc L 5Q&? Che frm 100 ftuxury Cnd and Single Family Hme thrughut the Chicagland area1 MOST BELOW BULDERS COST! iit: wwwnewlnrgerparkcm Call tday fr yur private hwing (866)151358 1 *Mnthly payment calculated with a purchae price f $2O55OO 25% dwn 299% 304% PR etimated mnthly prperty tax: $21 5 mnthly cnd aement: $163 *f* KOflß* HaUT RESDENTL LONS RODED THROUGH LNCOLN MORTGGE & FUNDNG Cni (tlnoi kfsjtntt M0R1GGL JCH45EE

DP a pineer pre pedal ectin aprii 302W) THE NNLL\L \t(j\i O 1kE YER CONTEST "i lve my mm bcxaue? She i my mm my friend my mentr and my cach She ha taught me me many different thing ince my birth until nw (fifteen year f age) My mmalway lking ut fr my bet interet by upprting and lving me My friendvery fun funny and int life lve hanging ut with my mm My mentr ha taught me almt everything abut what imprtant in life My cachencurage me try my bet in all f my prt activitie academic and everything ele d bysean Brnan 15 f Park Ridge lve my mm becaue he i alway there fr me lve her becaue whenever fall dwn he i the firt ne there t help me up She mther f five by and beide being a full time referee and chauffeur fr my brther and he a regitered nure My mm i alway extremely pitive and caring She the nly pern can really talk t and knw he will undertand me N ther mm culd d uch a great jb lving u a my mm can lve my mm fr jut wh he i by Brendan Brnan f Park Ridge lve my mm becaue there i imply n ne better then her «tu flk OU 1t di!fjt1h She i a ingle mm wh ha raied wnder f the wrld what me n her wn teaching me right frm wrng d gd in chl and everything ele yu have t teach a little girt She recently gt laid ff and time are tight but he till de her bet t give me everything want r need She will d withut t give me mething She tpped getting her hair and nail dne and de them herelf t make thing better fr me But in my eye thing are alway great when am arund her jut want t make her prud am nly 12 year ld but knw a lt f thing making me mre aware f hw much my mm mean t me ve alway knwn he wa pretty darn pecial lk back at my childhd in atnihment My mm rarely lt her temper alway had a mile n her face and lved me with n cnditin n matter what did wrng have mre repect fr her than knw hw t put int wrd nly hpe m half the mther yu are may nt alway hw my lve but believe me will alway lve my mm think he deerve t be the Mm f the Year becaue t me he i already that T me yu are the Eighth Wnder f the Wrld What an amazing wman bysamantha Marh 12 f Chicag O

lve my mm becaue he adre me care fr me and treat me the way a mther huld lve her becaue he intrduce me t many pprtunitie that will help me in life She i a rle mdel t me and teache me t be trng and take challenge lve hw my mm trie hard t keep u ut ftruble and fcu n chlwrk and afterchl clae N matter what lve my mm and knw my mm lve me back by kilah Fletcher f Chicag Mther Hg &ndg Mag l Trt Mm t n unfrttbl ml thi Mther g t Mgrn & Phil MiriKe yu1 NOW ølne N c11ry OUT r 3900 W Devn ve Lincinwd L 60712 8476776663 :in u tiiì w" Mther Day and make Mm RELLY Happy!»J Ìr: Tue Thur i 1:30 9 PM Fri & Sat 1:30 O PM Sun 5 9 PM 00 Main Street EvantnL 8473282255 my mm becaue he i a parent lve and nt a buddy r friend She i my bet friend and ultimately my mm My mm liten t me with caring ear and pen heart She guide me with quality advice and help me handle negative circumtance My mm i nt nly a mm t me; he i al a teacher She i mene wh prvide minitry and mentr her tudent She reache ut t them like her wn and they reciprcate t her like he i their real mm She teache Language rt/englih in the inner city chl f Chicag She i firm but care fr them a ifthey were her wn children When a tudent dent have lunch mney (he pay) he prvide aitance She pay fr tudent graduatin fee clthing and pecial uting and prvide them incentive t feel pecial She take and initiate pecial event ticket uch a the Chicag Bear Cub game the Chicag Bull and muic cncert ticket She al teache them and me that nt everyne i trutwrthy nt t be arrgant but cnfident in life in rder t accmplih ur gal She teache hnety and t walk in integrity in ur daily live reaping what yu w and t fear the Lrd the wrd f Gd and t bey Gd She al teache u t repect elder when they get lder My mther deerve thi award becaue he i ntjut my mm he i a mther t ther My mm famu wrd: "We will nt accept yu a yu are ntead we will hw yu a greater viin fwhat yu can becme and help yu achieve it" byjewell Lyd f Lincinwd lve my mm becaue he i a wnderful pern My mther make a hmecked meal everyday fr my father and 94yearld grandmther She al take care f my grandmther in their hmecut and tyle her hair dctr appintment medicatin upkeep and making ure he ue her walker t walk ide frm thi he vlunteer her time inging fr tw different church chir and end pecial card ut all year lng She i the glue that hld ur family tgetherfrm regular paghetti dinner every Sunday t the genuine lve and upprt he give her friend and family Our family wuldnt be the ame withut her by icki LBianc Peake f Nue n her mther ntinette Lßianc lve my mm becaue he ha hwn me what uncnditinal lve i really abut Her uncnditinal lve ha been the fundatin f ur relatinhip t ha created a healthy bnd where dnt want t diappint her by making the wrng chice when it cme t the btacle we a teenager will naturally face thank Gd fr allwing my mther t be uch an extrardinary rle mdel in my life She i the bet factr a girl can have in her life t make her realize which way i rightthank yu Mm lve yu byshawntrae Dugla f Maywd livemy mm becaue th r ug h ut my life he ha acrificed her time finance and cmfrt t prvide me with all that needed a a child and even nw in adulthd by reaching ut t me in any way within her mean My mther ha alway prvided me with fair and uncnditinal lve Our mther lve hwn t my brther and me wa mething that in childhd we didnt ee ften prvided t ur peer and even nw in adulthd till dnt ften ee We recgnize Beverly nn Wright a mther fthe year each and everyday by Deenna Wright f Fret Park On her mther Beverly nn Wright lve my mm becaue he i imply amazing N wrd can decribe by CurtneyDziadz ffranklin Park c we rec±e beverly ann %vri4kt a mther f the year each and everyday lve my mm becaue he ha alway been my rck my lace and my friend Whenever have a prblem can g t her fr advice a kind vvrd r a ckie She alway knw jut what t ay t help me thrugh the rugh time and he i alway there with me in the gd time by Terri McCannMicha!ki n her mther wh live in Nrthiake SUNDY MY btu $auet5 pcc(acular award winning Mtherb8yChnpngne Brunch : fenttir ver JOD decadenl iten rnnin frm ubhly C)mflplJgflC and Mima Oyter 1c1feer ced Juml ShEmDzeif Erch Snind and MeFOrdnr Oipc1et t hand Carved Prime Rib v: Nétndhig Deert Buffet! : ThkeYtir MOTHER t Smene E1e Kitehen MOTHERSDY SPECLS 11:00 am 9:00pm Rtierie Surf & Turf Rated Prk Freh Fih Filet Mignn Ocar Baked Stuffed Shrimp ETEN TKEWY PRTE PRTY RM LBLE 1740 Mflvnukecvtmue (at Lakeve) Glenview :4

c he can but a perfect mve lve my mm becaue he ha the mt unique characteritic Fr example he ha incredible dancing kill n any type f muic (frm rap t a waltz) he can but a perfect mve She taught me hw t dance well but till cant match her fabulu technique Nt nly de he have a great dancing tyle but he al ha an intereting mile/frwn cmbinatin that he ue t get a funny pint acr alway tart laughinq when he diplay that hilariu face think my mm i fantatic and cant imagine life withut her! by Delaney Rbert f Darien MOTHERS DY BRUNCH Sunday May 10th loam3:3opm Ham Beef and Turkey Carving Statin Omelet Egg Benedict and ther Breakfat Favrite Shrimp Seafd and Salmn Our Claic Renwned talian Dihe Deert Table and Jut fr Kid Table Champagne fr Mm $2995 dult $1499 Children 712 Children under 6 eat free nclude cffee Tax and gratuity extra CRLUCCT ce#ii#ic Special Dinner Menu 5 t 8pm RESERTONS 8475180990 OR : ONLNE T CRLUCCROSEMONTCOM P:te dining fr 5300 guet Cmplimentary curtey huttle 61 1 1 Nrth River Rad Remnt llini MENU ntipat Tray Hue Ted Salad Radiatre w/marinara Sauce Penne w/mara(a Sauce Chicken Breat Seame Rated Prime Rib French String Bean Baked Ptat Baked Sweet Ptat lve my mm becaue he i: kind helpful friendly lving caring pecial hardwrking mart teaching neat expert amazing by Luke Gldthrpe fburr Ridge Sunday May 10th Family S>le Luiiclien Seating Nn and 3 pm $250 per table Call fr Reervatin a Newlywed ice Cream Cake Rll Cah Bar 1lld Detû (708) tt561575 u$ CTOR ictria Beau Jlie 9950 Lawrence ve Schiller Park http://wwwvictriabanquetcm ach table erve 10 iid the eftver are yur t keep! per pern eated @ Captain table letter frcnn the cdi Thank Mrn fr the lve (flc()ndi(iml vc fadnate inc Thrugh the ç)%s f andcty md the height f cg tttc(?1dili()tl OC 11OtS unwtvcriflg ECO with tcfl1)crs flaring ;tfl(l inccurity pcnctrflttflg thc %h() give id reccivc tflco5ditio1t1 lve take CiflOtiOUfl hit with grace OtCO remind myelf1 d nt take advantage yur mther ttncnctitit! OC She ty mther pecifically ha never nce made me feel unlved r a il ltt) randm antic vcre burden SiTte althugh m Ltre they were btit tiv week ag called ny mm in t iratitic rage al)()tlt fielding rabid Sunday mrning phne call city driver blcking my car int the gtrage aci ubequently running late fr practice 01 curse lu) ptrt f the Were her fault lnt he knw hw need lier She knw need her lve my mm becaue " t liten t my breakdwn witluut the fear f cauing me inexplicable and permtent damage That uncnditinal lve; that ty tnt 1rm reading yur Mt f the Yeai uitmi Sinn lve learned that yur mther are lighter Battling caitcer battling iniitirtitne battling ytt Yur mther are teacher f life and academic They arc mart fahinable tid generu They vlunteer they miniter and they pelul a gd amunt l tune playing chauffeur rhey lcd yu They tuck yu in nd they are in yur eye ninazitig ck aplgize hr ty thievery; ltu tealing ttie ul yur (lte fr the end f my "1 hive ty incit becatie" letter Yur entiment happily reminded nie f niy wn tnt; ya)l jut ay it veii Email yur cmment t nichepublicatin@piofleorocai cm W welcme yur feedback PONEER PRESS 5511v tact (CF Mchele Wei Manager Niche Publicatin he inpire me t be a better pern" Tammy Matthew Special Sectin Editr tmatthew@pineerlocalcm t her lve i uncnditina)" Jennifer William Special Sectin Deigner " he gave me the curage t urvive brain urgery") [very effrt ha been made t enure the accuracy f the infrrnatn n (hi ecsn Thu Ptiblher O)flnt (luaraflic the crrectrea f all the rnfrnatrn available t thni arrd aume cr iabrlit nrne frm errr r rreln Crirmenthuld be erri t Odre PutrlícatinS Rne Pre Newpaper 3701 W Lake ve Glenvrew L 60026 rricrepublrcatirrspofleerlocal crir cpyrght?008 Pineer Pre ll nielui Çfeervd i 0pen i day [ UOCh Mnday thru Friday PRTE PRTY ROOM Upl 80 J 157 Planning Shwer Birthday Party Rehearal Dinner r Crprate Functin? CT RNG LBLE (847) 9670606 7620 N MLWUKEE NLES 2 Blck Suth f Oaktn Plenty 01 Parkng n Prmie wwwamlcifdcm Meii vailable Online l wwwamicifdcm Mther Day Open at Nn Cake (kie ifrecid Sft lretzet 3915 luhy ve JOCO1%%()Od 8415681750 Siii & ii 5:lihiiii tid l}iril Fri 5:3iiii Sa (w (piii Make Mtther Day Extra Special with Our Deliciu Cake Ckie Cupcake Freh Fruit ;: c Tart & Chclate Dipped Strawberrie CONGRTULTONS CLSS OF 2009111 Our Cake are Perfect fr ll Occain Tpped With Whipeream Buttercream r Fudge z & Filled with Freh Fruit Mue Cutard r Preerve Try Our Duble Chclate Mue r Freh Sirawbeny Whipereani Cake ll Cffee Cake $640 Dnut & Sweet Rll $900! Dten nd Mre Great Daily Special Bring in thi d & Get 20% ffll Rund r Sheet Cake Order ( cik (iikje lireai) Si lrcicl% Sbc aiwty iick un ty litittily titaking ante were hippy r it Lhrcc uiything c riced She kiv ruy yir(t(rirt nf t bic rti& Slui iiviyr chcck mv hntewc: k Yu iiiight jut think litt lying But priiikc lin tit t a ver bigjh atid %les very gnu at it Sinctinie J iiiiy lut ignre her but thv think he ha bcii tluugh ail cd tti lieb ire utd iie kitu bect t end up ditug what he íyi uv<uiki like t liiw it i niohilc f(i ich iiici bi cutil juirrt like lier She wiu ct tue be what t want She is alway willing t try liarder She let te itave a day where pick everything /i} 1110111 take tite time r malte my frindly a nice dinner which if yu get t knw t fwiily it i t hgulea]! She ha iniiiutuitied the 1erpceti thit "everything hippen fur a rean" Sie buy nie ty knw it han\ bec eacy She rued thíe hi1dtcu dnt vi1t t diu1ipniiic lier by nirukitig the iig chice Regardle f lily craay antic NDREWS OPEN PT et /2et Jet 4tni n /4t41( itit! She deerve the bet S why nt treat her t the bet nice dinner at the right place! DNE N r CRRY OUT FOR RESERTONS CLL: 8478243800 2610 Demptcr Park Ridge hl ul1uy will lve mcl upprt whatever it i citi ( )iui littic jiukc vill ieeii her iirighiiig ltr tli" Sh i tlwy there tr tule when iii hiving u 10cl tithe ltitr liti it) umili trict S litti ti t ti keep u 0111 uftrile f had t Wtit it bk abut all tie thhig yu have dune an&l acrificed (vr tite i wuld lever finkh llie rui lui i better bvciie nl 1cr uc ij; titi niaiiiig p115111 wh laugh u ud hive viti irait liuiiitu Slit t cuiter tirivitig u ti nuit ti ictith picking i up r i iyíitg hip tui e get hnte 1v1y ilito ir tu e1i;ttiiptii urvivct iit he i iiì) 0)0111 f the yccr tte iiici 1 ti lte hii uhvn tu ty bruuthcr trit rie wri ruut uetiiiiig tiiit iii cliiiu$iccl cc didnt "cc nitrit i uivitied r utili peer rut id evin 1105 lii rutluithxid tili t(r iii iìcti cue She i the glue that hultbi w liunily tgether She tell lit liciiicly rut3 t i ti integrity iii fur daily lice?uy çhericc;tiiìg& ue t ti lily bet ia :111 ni ty r;1turt u&iivitiei acttleinc and cery thing cl du t dcrc cin ii nit a cveckdi lily iti(itn tu rhilcic rutty tcicirilii She never tci buy fr nie think he the beat pern i hitvc ever kit)w! My ninth is the greatet thing that ha ever hiappeneul ) hic She liaten r my cetet and knw cuw tell her aflythiflg She 1irtCCtS tile She hiele tite all the tliiie titile Úiiic Site let tie get iii) cruic 1iicrtd She i ur vlentíne Tamrny Matthew rit t my lehnt Curul Flut uhu ittiutifutl Special Sectii Editr illiiuuuiu ill tu liirriti "Bet Greek Rtaurañt" "Bèt OutdrDifling" ÑtthShre Magazine 4t(jLj TERN q 1e peifect Øzcefr iwltñer Operfrm 11am Lunch & Dinner 7 day a week Periyali Greek Taverna 9860 N Mihaukee venue lut nrth f Glf Radmn Genvie% 8472962232 au! ay

u lve yu Mm becaue yu are mre than can ever ak fr Yu may nt be perfect but yu urely are cle t it lfmething ever cme up cme t yu Whether it i fr advice cmfrt r upprt yu are alway there cant imagine life withut yu nr d want t Yuve taught me dicipline repnibility and lve f had t write a bk abut all the thing yu have dne and acrificed fr me wuld never finih Yu lved me and knw yu alway wh lve yu Mm and culd nly hpe that ne day becme a great f a mther a yu had ti) writt n bk abut ;ill flx thng yu have dne and aciìfictd fr me i \()U1d newr fìflish m by Sara Olvera 16 fmeire Park 20% Off OfEverything* j May 7th 8th 9th lth *Except Trilbead the Stre W 1 R (t) 1 C T S iur: MnTheWed: 9:306:00 Thur&Fpj:9:308: Sat: 10:005:00 Sun: 11:005:00 11 Prpectve ParkRidge 8478232793 Cannt )C Cu ) )i ned vit h any t) t icr uf 1er i the bet mm ever becaue he i talented Mmm She can run a whle marathn! She i al great at helping peple She i great at helping peple that he make a living being a cial wrker My mm i great becaue he i alway there fr me when am having a hard time She help me whenever need help and i there fr me at all time That ijut a few way that my mm i great by Maya Fagen 10 f Evantn lve my mm becaue: She ck fr me every night She tuck nie int bed She help me She cmfrt me nd he i nice t me lve my mm byrubyfagen 7 f Evantn lve my mm becaue "1ÌY 1TL()ft tuht fl he int like anyne ele to S PSt th bviu My mm can never tay fld lk fr mre n mad fr lng One minute PCOPk and lve her he will be angry abut CTyday ibr that mething and the next he will be laughing abut it l my mm ha a great ene f humr One littlejke will keep her laughing fr day culd write abut hw my mm i the bet mm ever which ge untated r hw he i mart and pretty al true but my mm taught me t ee pat the bviu and lk fr mre in peple and lve her everyday fr that by rene and Mary Kay OCnnr friver Freit 1i«cUZ e4t c Specializing in Egyptian & frican Hair Style 754 5000 Mther Day Special FREE Haircut with clr r highlight Styte Cut Clr Cndit(nlng Treatment Mn Cled The Fri 9:00 am 7:00 pm Sat 8:00 am 6:00 pm Sun 8:00 ain 4:01) p1)] 58 1 7 St Charle fld Derkeley L 60163 : Táft &St; re Ràd We lve ur mm becaue even loowrd arentenugh t decribe thi amazing wman She a ingle mm t three teen wh wrk tw jb and teache an nternet cure t keep u clthed and fed t e She trict and enfrce her rule even in the face f the "lgical argument againt them" cming frm the three f u She tugh but we alway knw were lved She never pend anything r anytime n herelf She attend every hme game r meet that we have in the evening She i either driving u and ur friend picking u up r taying up till we get hme by Henry Maddie and Griffin Herme n their mther Tricia lve my mm becaue he inpire me t be a better pern She make peple the pririty in her life and nt thing She age gracefully withut artificially induced beauty She never alter her value r belief t meet ppular trend She lve deeply and laugh ften My mther i andwiched between the family repnibilitie f being a daughter a mther a grandmther and a wife f ver 30 year She apprache all thee rle with a tender heart and unwavering cmpainthe wrld i better becaue f her byiennifer McGee Prechern 32 f Evantn On her mther Clare McGee frlingtn Height 4 Mther Day at Edelwei ll Mther receive a gla f champagne Special Menu prime rib freh fih rt duk titel mignn tuffed prk lin veal amb hank and all yur Grman favrila Children menu available Seating at fl:30 2:OO 1:30 2:30 4:00 and 5:00 Live Muic Jhnny Wagner Make ur reervatin earl LE ENTERTNMENT ON WEEKENDS Spargel & Maifet pril 24 thru May 9 Rat Suckling Pi Dinner LLYOUCNET FRDY FSH FRY LWTCH EUROPEN SOCCER GMES ON OUR BG SCREEN German mcrlcai Cu ii ne wwwedelweidiningcm 7650 W RNGPRK RD NORRDGE 7O4526O4O ç; 3wì? Bakey Cakevy Cafè ( Bring Mm a cupcake a weet a he i! i aed gdne5 cookies anj mre iiiing kc 7931 Lncln ve Skkie L Dwntwn Skkie eeeeöxate jítgmex Zia Tratt r 6699 N Nrthwet Highway Chicag (Ed n Park) il 7737750808 2açí Stj&!!! 4 cure family tyle Champagne Brunch vaflability frm llam3pm Open fr regular dinner ervice frm 4pm8pm Make yur reervatin nw!! Pleae Call 7737750808 Limited Seating vailable Cake Cupcake and Pie Gift Tray and rtment Open Mther Day 8am t 3pm 10% Dicunt with $10 purchae and thi ad 8472130900 wwwweetiplebakerycm huncñ Sunday May 10 2009 Fur curefamily tyle Champagne Brunch (menu ubject t change) COU!PS!E OWE t Egg Flrentine Pached egg n garlic tat with pinach and tewed tmate Frittata Di erdura talian tyle melet pie with zucchini yellw quah nin and pepper Briche French Tat Wicnin Slab Bacn c!f5!eqa nalata Della Caa Mixed talian green with chpped tmate and a red wine vinaigrette COWFJ!E tee Rated Leg f Lamb Salmn with caper and lemn Chicken breat with muhrm and pea Penne rrabbiata Brccli with bread crumb egg and parley cq:l$e 9:OZQ Tiramiu with freh berrie $2795 per pern + tax gratuity $1295 kid 12 and under

Banquet & Catering fr nil yur need 4? Prei Seafd Daily Caual(ncph&e lj) Live lnler1ainnent Deliciu Sleak & C/w Ojen fr Liutca & Dinner Daily Carryui tvailale Jin U Fr Our Mther Day $2795 Champagne Brunch Buffet dtilt On Sunday May 10th! $1195 am Clildrcnt 1O00 500 ftc Mntr lrntu lii ttly) njy OverßSavryFavrilel PcaturingCaMngStatin PrchScafnd 4 nd land Carved lrime Rib! Dinner Fllwed By Sweet nd Deertl cmplimentary Mima & Champagne p Rcervatin Required S Call bday! (1 TE 688) N Mllwaukeee Mile L Hue f Cake Order Nw fr Mther Day! Were Yur headquarter fr ll Special Occanin cake Jin u fr a Spectacular Dining Experience in the pringlike atmphere f ur garden atrium Champagne & Mima Gr(umuutin Cuintiiunr t fe(ldiug Cake Y4À iliih 11iLk FF1ÍS2 Cpn 63ON NM D514* Wry DyneOupOflt Opnf31Oe Dy yldy w Dry WO Oupnt Hur: Tueday Sat 75 Sunday 712 6189 N Canfield Rd Chicag L 60631 7737740440 10:30 uni and 1:00 pm Seating vailable Gurmet Bullet featuring: Traditinal Breakfat Selectin ncluding MadetOrder Omelette Extenive Salad Preentatin Seafd Statin Carving Statin f kiked Ham Rat Thrkey & Prime Rib rray f Lunchen Entree Children Buffet llvih Deert Diplay $3200 dult $2800 Senir (65 and lder) $1500 Children (aie 513) Children under 4 are FREE Plu ervire charge cii:c Suie lux Private Diuii:g Sui(e tvailabh WYN DHM GLEN EW SUTES Reervatin highly recmmended by May O 8477597574 OF 1400 Mlwaukee ve Glenvlew 8478039Ó00 Lcated neat dr tu BT Etictrni & acr tram the Hltrjc 60v Nature Center i lve my mm becaue he had an awful year and urvived She gt breat cancer had a matectmy and chemtherapy My father gt a new jb and mved t Chicag flying hme n weekend Mm felt verwhelmed and the drug depreed her; he pent ix day in the hpital My mm wa ick he tpped chemtherapy and wrk We mved t Chicag in Octber Mm happily recvered i cancerfree and her hair grew in Watching her g thrugh thi experience have learned that beauty cme in all way My mm i a champin urvivr and he i my mm f the year by Pamela Kekt 12 f Lincinhire On her mther Nancy lve my mm becaue he i the trnget pern knw She hld true t her value n matter what and ha perevered thrugh mre truggle than lve ever een anyne deal withthrughut her entire life he ha maintained the perpective that "everything happen fr a rean"and "mene alway ha it wre than u" When we were almt hmele he wa at church flding clthe fr the le frtunate than u She tuche everyne he meet and never turn dwn an ffer t help My mther i my rle mdel my inpiratin and my cheerleader by Kelly Strumill f Lemnt On her mther Karen Strumill She take care f me lve me and alway tay pitive abut my mitake when me up My mm alway de her bet t make u happyl fter a rugh day at chl my mm will have a nice warm mile and a hug fr me t cme hme t Every night my mm take the time t make my family a nice dinner which ifyu get t knw ur family it i a big deal! The rean m ding thi i becaue my mm deerve it and lve her with all my heart n matter what by Kevin Schiff f Eimhurt my mm i a champin urvivr c my mm take the time t make my filmily a nice dinner which if yu get t knw ur family i a big deal

THE<>EXC HNGE tet (j6l M r ji r M k wiiri 2300 Skkie lley Rd HiOhnd Prk 1 2490 Skkre lley Rd Highland Prk L 847} 2667000 (847) 4325020 www4prchccm wwwaudexchnrigecni Sherwd Terrace Luke Blull li (847) 6151111 w w w a a b exc h a n g e cm

tarniancórn N GROSSNGERUTOPLEXCOM * 8666702601 NS SN C H C GO CO M SUBRUCHCGOCOM C) (D1uruc: DRGÑb POR Cfl E cg New 09 CTS MSRP1 $39660 2Z%( $L91 $30745 OER 600 BRND NEW EHCLES FNL! 80427 New : Ecalade MSRP1 $61180 $46995* M$ltP $3$5 DSCOUNT 30% t41ø5 OFF! BERSHC YEHlLE EDEL 52059 STOCK *9451 fl2859 4 T ThS PRcE ZERO Pf! (TS FOR 90 DYS C) C) g ç w P90060 New 09 Gó MSRP $20520 22% ff $15990 v 09 Yukn MSRP $37405 2LQuî $27995 3 DY/150 MLE EXCHNGE POLCY 03 Ddq GRND CRN 39g5 ONLl 5OO øow Mile E ñht dee 94 iii!! iuth f Tuh OMtORF NO CREDT 05 Pntiac BO CREDT GO 00 %øp GRJWHEROJÇ 7p_ 4x4 5995:89i ONLY %OO DOWN! $a995 j135 ONlY Dwfl p M$i $3JS5 u Fi 12 uqy $5 1SUW4 XU4S& $5Jg5 vv LT a Sc* *fl5 am $5J$5 thui " ucctg MS7O $llft5! r 72 Ñnfh T SHORT TMEON THE JOB SNORT TME N THE COUNTRY COTJOB& 199 DOWN? YOURE PPROED! CLL NOW 8666124635 ONLY 500 Family Owned Since 1928 1008 DODGE GRND CRN X6654 b:k 007 CDULC ESCLDE ONLY SOO DOWN! eiqo 09 Cadillac n Lxu ESCLDE RX300 M rebate und inceniive applied ffer tu qualified huya & dc t (r 04 mcc Excludc tax titlehc & dc at 115% PEl (t Si 711 pr mu yhigig price 90U05 (ih34 5ffl dwn Plu lx liti ie& dc fe fr 04 7) Ul MSP n elct mu at BD%pJi t1oo3 nw mdl pr nloou financed) ) MSFP may nt b thu put ctu eliü t UW fr 72 mu t qclitid buyci 1OÜO finnced) (1J1Qß dwn plu taxtitte lic pric within ifi trdin area Pht (D utrtl n elect mdel in lin cl rebat nly Ulr will & incnhlva ($1302 pur SlO wnnceü} nt hnr pricitig rrr in thi ad Olfr end 3 day llar phbliclin w S?M cga 995152 Oft5M52" ONLY a DOWN ONLY SO DOWN! 1Faii 80364 New 08 G8 MSRP $27595 lz%ß S4470 ; $22890 390444 New 09 Lucerne MSRP $29970 27% ff $7975 Nw * On1y 1y/ NEW & PREDR1EN LFETME WRRNTY rbc $T$ cwveipr x6u 15ugap Xx! &detxu34 T$ x6450 *p*1 W53 CT$ 211wN3c*vL B9M)L 05 Cadillac CTS llctawyuft15 1 OFJTlC :: L $t Weve Been Here Fr Lifetime Well Back Yu Fr Lifetime! 6900 N McCrmick Blvd * LflCOflWOOd L 60712 GROSSNGERUTOPLEXCOM 8666702601 cxp 1ø95248 ONLY %OO DOWN! NEW 2009 NSSNS! MD CTY NSSN USED OUTLET 02 lyla NiMander $7995 05 Nivan fum 8995 06 NiOOan SOfTO 8995 O2Tyla R4 $9995 06 Mazda 3 $9995 :01 TytCrll LE 010995 08 Nian Stica 10995 06 Hnda ccrd 11995 05 Subani F018812! QNt i5tul 13995 05 Nin Maxima 13995 05 Niian Murat 13995 06 lyla Maux 13995 g Su Lgy 15995 06 Subaru 69 Thbeca ti! 16995 08 Nian Ragt 17995 05 ntriti FX35 22995 MSRP GET OUR BGGEST POSSBLE SNGS ON TOP SELLNG NS$NMODELS! 30% OFF! DERTSNG EMCE MODEL 42719 ST0CKf9615 M$RP 2O?7O DScOUNT 6231 30% OFF! Dl Nizan ttim S1 $4995 02 Pntiac Snfir 4 $4995 03 luick Rendezvu$ 1348 8995 04 Nuan 0uit4 91995 04 Tyta Sienna p11995 05 Jep Ubtty fllk D Wit Pauat521 06 Nian Maxima & 14995 N295i 4 T THiS PRCE DERTiSNG EHCLE MODEL 05819 STDCK#9313 #112616 4 T Till PRCE STR NSSN USED OUTLET 07 llth clvi tttly fr00111 15995 05 Hnda Pi1t *16995 5 Nian rtn 4x4R41dL 16995 ai Jp CmrnandarSí36M 16995 05 tafratiec4x4 tei Cab R 1 7995 Dl Tyta Tundra 513 97995 05 Nivm Pathfinder LE S19 19995 06kifmiti M35 4l1 21995? NSSN L 4444 W RNG PRK CHCGO // 5757 W TOLJH ENUE thies 8885908666 midcityniancm 8885987491 nlnp5ijd $)2R ÑEwT2j Flifitei lr tiem l(h/ii$c Lwe lm1w* lckuiirrcd; NEW"2 OtHCK 2 v Pwr wn/k murare 0; kelamt entry R mrel ThlRft 5 Pa Pwer wi/lckt mirrr: CO: keyleu eray& mrel 2009 MOTOR TREND SPORT/UTLTY f the YER" e$! 8n818WaY tanal tilt SUBRU CHECK OUT OURWEBSTE FOR NEW ND USED CR SPECLS: SUBRUCHCGOCOM 4330 W RNG PRK CHCGO 8885987467 ;4i SUBRLJ Miffwiple lajlitlijc &decfit tif ued papitltiayeffecl rulic lyael lliñale: ad iathaplt h priiut icrtle luuasaeafohr tdl üyha j C O 1* 3 z

ç th;1 g 0 45 44 S lt 37 25 4 3 t DOWN 1Dubü 3 Shey pant Jcaie 5 Fømir Dcj cmn 8 FØndOÇ wrund 9Bx pmtc 11:crMtJ ma3ureme(t 12 Tny Slark crúhj dde : 13 Optin avaabje n 1929 14 Cnffdecb«Suzuki i 6 ntemaffj SpOiliite i 7 ßrazrnanKja? 18 PJne drp n here 19 PCR btr (utng 47 COPYRGHT WHEELOSECOUUUNCTONS 45 l 24 t 37 3e 4 7 43 20 FnJ vc cmmand 23 aka undertç 25 RUa cnvertble 20Mnrpanei 30 Sumpertbumpr feature 32Tmnferç«34Di:jpa : 37 Caddy Cnvevj baed n thi 38hckhc 40 Thelecg wheel 39 H&p mcept 41 Hadlamp rls4 n pertdc table elemang 30 45 Manuaftran lang Paaengeratterm u 33 4g t 1;5 C RO S S k 2 ul car brand 4Waxwrfç 7 Hyunclal cupe r edan t 9 Eaily Prathe nickname 1OFender i 3 The ut edge f a wheel i 5 Drp the ride height (lang) 18 Cbalt replacement 19 Oveihaujln theme ng 21 Ppular windw treatment nce 22 utßawn mwer nventr 24 Dnt let thi lip : 26 Dauphne r Caravelle 27 Help aerdynaml Halfplckup halber al Battey hld thi 33 Tire nie Tre neceity nce Diagntic lang 40 42 Wden wheel Supprt \ 44 Q45 G3SX QXS6 mdel 45 One Hnda Sprtute ; 46 aka tra1ghr ix Small yellwtruck maker Ddge wagn ffered in SRTB trim : 49 8ack fr Fatand the FUrOUS 4 50 Ughining MQueen idekick : 51Jagrleunr w ERS ; jdyeruntmecn JMER323212ò» NKRPúiLcnNi : DN CHLL : 3123212775 dcahlll@untjmccóm : :» RcNcHlCùT$ JLL C1MNNLO:: : 232ù685 jciminl(@untjmec :» NCHE pueutà JOHN LEMEN :: 3123213094 jlemein@untjmec» UTMaT$jj TERRNCE BOYLE7O88O25O31 tboye@ùntlmeccrnì GEORGE MOLNR 6309188194 gmnar@cn1 1e* MCHELNTHN :: 3123212975: mnathan@untjmem contact$) p 3123212685fe autòedichicagcrri Schchkag CHCG "(1i : 59 NOrfean St 10N Chicag L 60654 GE fádi ths* ÑtJN BèacnNew : Np PxNipijj Hir r BRND HEW 2009 FORD FOCUS ii i rl «U4titL tmw 0% PR LtBLCl i 0991 189 BRNDNCW2009 FORD RNGER WEL iteera 1iu _9tPlltu*nøt1 $1 2889l 21 9 05 STURN ON SEDN E POStO LD& 798925169 03 FORD FOCUS WGON lt uw_guld443 7751g 10031 aliw 0E1S t 7410 5014301113010025 8989 1 99 D NSSN FRONTER CREW CB 4X4= 5il3l 04110 tosto l wwnlll 12*302001025 1O989 239 03 FORO E250 CRGO N lilt 3011525 6989149 02 JEEP W30NGLER SPORT 4X4 mgwllenen nti au 521011* 1O989239 04 GMC ENOY SlT4X4 Óauwm GRND 7TJO 4X4 O3WGOLPGtS ly13t*0 l MiiYrfn_&l1R_ UmNEW 2009 FORD FUSON S lotwr 515254 1 12511 1tW300 *11371111072534 9989219 02 SUZUO F05011115 EX 133eXlu 7501003 EED* t11252530130137*l03 Y 5*117 111144111 51098W0 239 01 CHRYSLER TOWN &COUNTRYLX 1l 704 1WN44 10 *125 Ea00130*t0ll1S 005025 1O98970 f239 MNO NEW 2009 "i*_ FORD EDGE rxm*ueeg; SluRE RllOtiee $2199115$379t ranfgtr9lçt3rm$a TD1 10K fllmw1 t*1flfl OER 400 QUL1Y PWNED EHcLES LBLE FOR EERY BUDGE11 57 MTSUSSH LNCER ES Ol/ PR OMLOU CHRYSLER PCFC TOURnG _ L; iui2t3gg ta; ai na viu&niiva a Ml30lCTt107i Ttl_ 04 5*12 StO 1O989239 07 TOYOT RUS 304011 30153011 lri317al 0 125 *511 11511110 i 0989 f239 OS FORO 7U XT 25725225 5302575*01251 1 **t411 l017t300251 5*1101150 252500*2510 14989299 01 DODGE GRND CRN 107 04075505 na NP0tR1 0 lu 25501 1100*1111* 14989 e 299 i O? CHEY COBLT LS SEDN 532*1*12117301025541 P0*15 tes OWN TU 055T 113230510*1110 1O989 239 OS NUSSN LTUM SE *111010104330257501 led *WN1 01103025121 u20111llnlc 11989259 04 DC SERR 51E EXT CO 1*01 1035 17001E latt POMO l 110X5111125030125 1*0_n 501251507 14989 299 05 chrysler TOWN L COUNTRY UMUED Pia 121710E 1701*1104415 5*51111255311101111 11O* 15989319 á*lùcvrynùwidtrer *300 LWWflYED BRNDNEW200B FORD F150 BRNDNEW 2009 FORD ESCPE rmtew ut n*it FCTOMtUYZ1tf Pfl tltot $1 4989 249 au 1O989239t i4989:299 14989!299 6989i49 6989 949 ml SLES HOURS: MONFR 9M9PM ST 9M7PM SERCE & RTS HOURS: MONTHURS 7MOPM FR TM7PM ST 8 M5PM : SCEDP ON LMUOPN UN1L top lp ai WL thu tots 1iGU! *tsn POtSH US511 GtUK GG%tt tngusg GPRO &StYRtJ YOUR UTHORZED QUCK LNE DELER 00n t 18668764400 4Q*k NrS ri G FRO rl (S & 7CJ rf e3 2l3 r _ 1 C7 7 E UU t i:it Uí cl 7:H i t j auli b :aitj ii t3cie: T N O Rl H t t! Ot t 02 t 051 1 0 lljuktt OU rit O 7t f flocw 2009 } f U9 lu n O9 fu Eir 21Ü t Ut9 Fc i J i16 ïcr:?utu:lit 1 1 3 i: 2OOtP i t 294 COt1UG rrom rut uîu :ta ief :i!li :3 ii9!3 i: i i! r; uii: SU) Ù?! t Pij ii ;? TY i i:ç Úut;i Htt1ODCHt 3E1 t X Dt 71751 t P t OS T O M t3uk (7 t 00 1H / 9 jy ; S500 it pircii SW 1100 1 :? 8 i i? : th L lr7: lti:i E 4 1P1 0T0 t t h1721t? O H H JP?U RtCC it i ìi ii::i p :i : i r i P :i: i 425auLßSutL Hi ENUNzY7$0O3 i59893w 19% SPECL FNNCiNG LBE ON PREOWNED EHCLES ONLY T GOLF MLL F0001 SPCtL WUNCHQ t*t(f 14391249 luanl2timfn& L 159$19 WOQdOd77!Wd7O9MMM WÓJGdOJ17Wd7ODMMM wjadd77!lnd7!ymmm j l ONLY $500 DOWN DELERS!t MLPYMENTS NCLUS 11*1 TUT1&LKNSSDOC Flail O? 0000E CLBER RT *21*112 1Ul 10 DES *10115 P7*011273* 5125E *111)01013100111*1* i 1989259 2 Ȧ 07 SONT als S MJ1SOREUEOOM)0 1a4LlOO1*412101 12989 279 07 DODGE RM QUD CB OLT HEW 0120010101011 POMO 1003 *W104111U25O30L302T 0111111111 1698944339 QQ CHEY 2800 CRGO N *0131011 254372517 18989349 crnd xpaemn XJT4X 10 FRi 53033 15503 101 05* 11 13012 17025311* 5159S9*319 FORD EXPLORER! S BRND NW 2009 FORD MUSTNG 0 ROGUE Mte!wraLtcm 16491279 G YER1Oß000 MLE_WRRNTY 1* ML PßW EUU$ ST (1S2417T WWWGOLFMLLFORDCOM 07 NSSN SEPOT25 SEL SEDN 40 MJT10UOE TB25 POMO 10031 3*11 11110300103 0M 115*51551015425 12989 279 ER 34125 01 P0*00 5100 UL2lWfl2LOl 1111505*25 511111110 1498ø 299 FORO F150 CREW COD Xii 4X4 512255 : U507111 5442m *13030107510 LED 151204 000572551*72111725125 005112*3001111110334 24989469 FORO E350 KU 01È 5t41142 *1110110 lw0* 1ff111W151 5*251710 ilselull 21989«4O9 : _ BRND NEW 2008 FORD F250 SUPERDUTY lt 5TTEl* 5155551 Ob EP X 0O MOUTHS! $1 6881 289 139B9 9 C i: e 1E i O 1EmunlM1OYDTcO PR LBLE T Hull mwn WM OThERS TELL YlK TUFS NO C$1lT NULE FORO crect REDY TO lift? YOU RRE YOUR FORO YENCL BUY OR LESE NEW EHCLE ND WELL COER YOUR PYMENTS FOR LP TO 12 MONTHS F YOU LOSE YOUR PYCHECK4 BRND NEW 2008 18 5*5 1L1150 5544 505 O9 BRND NEW ie FORD EXPtOER KT ee ee*ra Tv pw L_1w_ w it ran!npn M 60 MEHSt i 9999 $339 BRND NEW 2009 FORD FLEX6 0% Pft 0UtLfl8t lul 22871$379 i 7 NFN1á3* PONTC GRNO PRX Ql S 07 "414 10002 POPU*Ot1000&álU42 L;055011Q*l51132 24989469 e O O O O O

vr 2 E 0 e " alway with The utbarn yu can aume well have a great electin at a great vaue uj mazda COMPLETEjy REDESGNED w P* 2010 MZD3S RE HERE 1$ i i N Mulu 2008 MZDSPEED3 SPT Sd864a Buyf 17g7 # i Stre in llini fc 06 07 & ò8 accrn1ing t MNO) Brand New 2009 MZØ61 Sprt Uthant 5 ; : v 12e t ; 2008 MZD3 Turing ut C Tet Drive a Mazda Tdayt afeseciifty raeage C lee M recate & rerdive the : : the ;ße5 due at ee Sflhi Na tecuilty depft rquirj 2008 Mazda MX5 Mlata if UiThp ver$erjgg g$2 547 Mw 200 Mazda CXØ GiM Tu1ng MMiee SdJ Mazda 1015 Chicag venue Evantn 8478669666 32779Oz " e3da)ndateit 0% ac26maza CXib O0ec ere3day Dm Da ut New 2009 lkwagen Rutan FROM $5000 TO $8000 p O% OÂPP frnain 2009 ikgti Pukn PR fr ic 72 (T3 Thru h acprd Offer 72 ma end Of3O/O9 See cleaer fr deiiff r! ;::/r Leaefr l89m/36 m : UY anali 2OO9m 36 n eda ecec J &n4e Ç33 nt Siìij4 e bieo1w? G ia w 2009 jkwagen Jetta S %PRfr 36 m Qtdkr rexe ffftr &ORt4r SytriCC bç4 Txg tn Md : kene &dxee E 41»!erc te(pxr the limited iu fl G:ivetei J Lí kwagen 1033 Chicag venue Evantn 8478667600 Wwwvwfcvantncm f Jut Minute way in Evantn We are lcated in dwntwn n Chicag vönu kae JSt:ò:c C NTÒ TENT EE Leae fr 2009 Nian ltimas 1f Nian Rgue FWD S /1_ j;t 2005 Nln luma 33K M StMN1eaj 2000 N**n ltcm 33k Mi Sk#npgg 2007 N1*n Qut 32k M StkNP1O31 2007 Nuan Quet 23KM1 Stk#Np1032 2008 Nan luma 2KM StkeNPlQ4 2003 Chvy Mnt Care udrnpl300 2009 Nan ltinta 6K M StkNNPuaB 2008 Nmn *Un 19< M SU1NP1131 2006 nfinty Q3ß SUpOrChared lii< MSeçtt1P839 2007 Ntn 350Z 18KM Stk$Np4 /m per 39 m $29OOc3wn atlea &gnng N ecu d) required $11927 $12927 $12927 $14927 $15927 $16927 $16927 $17927 $18927 $18927 $23927 $24 927 #1 Fatet Grwin Nian Stre in L fr 2006 2007 & 2008 eeer fexa eager 12Kmlex bte kene ei3cfa Dea tref me1iemen1 the 1034 Chicag venue Evantn 8474758200 Wwwautbanntm lway Over 3OOPredrjve Suburban ehicle vaîcbje Nluan 0/ Curre Mtr $500$1250 K 12 Muth vailable! r iflt a); 2008 CHEY COR ETE CO!J ERTBLE P ii ; d r 4 i j ;ii 1k ::; i Dir MSRP S6(i 625 12000 OFF MSRP!!!? NCE PEOPLE TO DO BUSNESS WTH Ìfl Rebate! CHE RDLET F FOREST Over 500 PreDriven Car vailable N GM Certified Ued Cme wth a 12 Mnth! 12000 Mle Bumper t Bumper Warrantj PLUS a 5 Year/100000 Mil Pwerfratn Umfted Wananty == f_ ( 1a&Y w ttal cnfidence utke ;fíect5 )J : $Mt& t?m7 LODSD Ni MOO t8 PM $2 905 995 mu_ NL5 ; ; vr J LX 3ßMW5P1 LidNP4N 5SLN 7995: i LST DY TODY!llDONJ WT!! $3 gg: w *Pi 5 1_1 Mi e piu $3 995; 41m & uw LWtL1 & P1NM y : g9 34iieió 11995 i59/íñ i 3995 u:$191/rn 14 995S207inu CLL TODY OR *HOP ONLE 4 4OUS DY WWW Jrri hvy aam rit/ C;re:di :!;?/cuyie Mtr 7901 ROOSEELT RD PL TO DO r Well Beat ny Deál n ny NewChe! 4 r L SLES: MF 99 a ST 97 1 SERCE: CHES LET OF FOREST PRK wwwcurrihvycm MF 76 & ST 94 q1aei FOREST PRK3 L edmtt EERY time! :101 i 6850t r $2391m** _ ind9 cuuevrttuei 0E rt K%4j $28995ir$43O/rnó «flaffahie!4 :ZN4 NECN REOW11ONk) edøb eetibt bletee bbrut *reiet We&erÌ SbTmre be*odre% b j t 3 z E

O t) t) WHEN GRET DEL MTTERS SHOP ROB PDDORS ENSTON SUBRU #1 SUBRU DELERSHP N LLNOSFOR 2008 & 2009 BRMÒ NEW 2009 SUBRU LEGCY 2u51 SPECL EDTON SEDN ::: :=::=;u:: J i u i U a u w a a _ u a w a e t SUBRU 2S MPGHwy LBERTY i?lpursu!r E FOLEY 4me f Nórthbrk fr m S2 r i DELER n ll/m Nbdy bargeld Mre Cadillac n llni 1 MiP 63835 R6alE O Áp) )Ç 1yr(EY/GClxPì $2238 Leee Save an dditinal 25OO! NO SECURTY DEPOST 36 mnth leae $2849 due at igning Dnt Be Fled Our Leae nclude the cquiitin Fee llwheeldrive Pwer Windw Pwer Lck Pwer Seat Mud Guard lly Wheel and Mre! MSRP $24931 9D #4673 ElND MEW 2009 SUBRU MPREZ 251 SEDN NO SECURfly DEPOS 36 mnth leae ai $2495 due at igning #4715 MPORTS & DOMESTCS Qe Miul Cøfm S CiiuvuiL u? Speed 271Ç Dark Blue 14680 Niuda cct H$amut Leather Sunrcf aded 6ey 1437M 07 cø S1 li Th a Lcathe: Su000f 24X Black 1P3243 Hieda cci LX utmaucnr Full Pwer 4124k v LX 4x4 07 i0wne SJJvm 27Ç like tew 48284 $40 24i ut Sunrtpjy 84y 26K 8L&clç P3379 * Nt** LS 5* ut Leauiei Sunrt84y 04 1MW 325J Sltver 4807 ut Lcathe Sunml thw Mlle Wbfle C4 32O 4Mic Wag 48010 teaue Strn! Black P3291 07 a! Spu1it $ 5unrf 2*c1i Green r Blue P3376/77 huda L WD 1* Mlza 3 4zitmatJc like New 0rang 47k P3338 utmalcnk3y ulce New Back P3374 li J ftra 4x4 ljln3atjc Mut Se 0Lck P3375 102 ulve XC7*p Wteathei; Sunrf 1Oej OZ 3a a 66K 48254 S2 #)toflatlcmr Lathei Suwf 71K 1474t mr 4x4 ß ul ENSTON FUJ Pwe Red 1P33154 Check ut ur Weekly nternet Special Ma at wwwevantnstjbarucm Cal TOl Free D 60 U dalr ( credit dobus Md Plie icen and $15165 c fe rebat applied 04 Maz UntJ 5 SPeedJy ftir Yellw 44K P3185 95 Muda 3 23 Sdan $10995 *itmau SUver Nly lp3tm 04 ludi Ct NYRm $9995 utmau 02 Maz ir Full Pwer 4641k 5 Wan#ut 9995 Sunrø My 30K Y&lw P3312 04 SMut i 59996 Leather Sunrt utrnatic Mntf Black 02 Nida ccu #P32234 $7995 dmticpjr 681Ç P33254 1995 NCELY EQUPPED WTH BRND NEW 2009 SUBRU FORESTER 25X BRND NEW 2OO SUØRU 2009 MOTOR SEND SPORT/Ufiffly f the YEH" 251 WGON NO SECURY DEPOST! JL$LE 36 mnth leae NO SECURtY DEPOST! 26 MPS : $2849 due at igning 36 mnth leae 90 9F #4826 ç $2894 due at gning #4474 SUBRU FORESTERS 09 Suenj Fir LbM Sun! Lthi Tw Pkg Stive 81Ç P3380 $24996 09 FteW Pum ut SunrfJly Syer/RediOu 3tthe $17996 06 Sjbaiv Frtj Xp Sunrt Natedeay Gmy 28K P3382 $18996 96 Subaru Frei X $ 0g $uii SUBRU TUBECS Mtily 8t4Jtve P3318/58/73 $15995 ca DWki 06 Subanj i paeng Bact 9K P3352 Lt liai Etk Sunr Leather 96 Sibii N 7 1995 501Ç 47774 $15995 Leather Sunr ctarca P3383 196 Su *ca iv/0tp 7 Pag 4)996 Leather Sunrf 16K P3393 $130MW LEGCy OUTBCKS eci UiL 7p 4996 09 Subnj 0vth Suri Lcathe Brnz P3290 LtdLthr SunrLNly 5tctmeM Clr 07 $am M 6 P3370 $21995 0$ Sub teathe Sunr 21K #4428 ONl8ack 251 LWunri Uhr Ñdmatic $21996 Whte 4P3280 $19996 09 SUBRU MPREzS 09 Sabtj Oul8adc jt MCt 8tDctC PfSzl Prim 64k P3342 $18995 t $17996 09 Legacy 261 SE lt kaiza Pram 5O $11995 3tPck 8P3303(64(65 $11995 wtmauc Slu r Gld P3362/63 518996 96 OUtb2d( 251 it Blue r Gtd 4tche P3248 $16995 t TaCCOL Rd Blue P334ftj $15995 07 SE 515$ 0e Subaru Legacy SE Sida gt Sun00f ty Hiack P3378 481341P3300 $15495 512996 07 Sub&n Legacy 251 5E Sidan Blue 1P3229 $12995 SUB STELLR4 PERFORMER k abut Ciieg Graduate Prgram email:diiewman@evnicm m2eag EP Etimate Leae n Optin Purchae; Freter $11 793 appr imprza $11879 Outhack $1 1940 Legacy $14459 fbaed n New Subaru retch cat (rar SC n Uin fr all f 2Q08 & JarvFeb 2009 715 CHCGO E ltflii WU1U crìt cre La 10k Rb p y 15 cen alter Leee repnjb fr exce wear and cady tenat80 f ca M ffer end n 3 day n Ñew 2009 Ecaiade Ecalade Hybrid Ecalade ES Ecalade EXT DTS 00000 MlLE _ P9104 2005CTS36 GOLOMST $17199 Pg 200SCTS3 P9247 2006 CTS 3M MOONSTONE $18995 90844 2008 CTS38 SNDSTORM $15995 P9177 2008 CTS3$ PlTNUM $21995 P9146 2008 CTS 38 DtCK S1995 P9102 2000 CTS WnnDMóND P9205 2009 CTS 38 THUNDER 69E/GREY t0939 2009 CTS SLCK P0923 P9338 P9t03 P0217 P0324 P0303 2007 UTS 2006 DTS 200 UTS 2006 UTS 2007 UTS 2007 UTS P9329 2003 ESCLDE WO Prduct Prtectin: Fully Backed 5yeàr 100000 MOe Pwertrain Tranateriabfe Warrarty pfuc Radide itance and Curtey Tranprtatin The bet cverage in merica DTS ESCLDE 100 Skkie Blvd 4 PlTNUM WHTE 6?DNO WHTE LGHTNNG PES1JED SLCK PENTN U M NORTHBROOK L 60062 ne blck wet f the Eden between Lake Ck & Dundee mad PLTNUM $17995 SLCK P9350 2006 ESCLDE SLOE Eli/P 925t0 2007 ESCLDE Wl) p935 2007 FSCLMEWD RLPK $27995 P9304 $20999 995 P P9323 $22995 igi $25995 pgte $25999 $26995 $28995 996 4 Family Prtectin: The ately and ecurity f OnStar tandard fr ne year utmatic crah repne ehicle diagntic Stlen vehicle aitance tan dard fr ne year n every Cadde Pa 2000 ESCLDE WO P9300 2000 ESClDE WO P9310 2008 ESCLDEWU P9353 2008 ESCLDE 88 P9352 2008 ESClUDE WO 92044 68170 85774 99349 90078 81/ON 90253 99349 2000 200S SXWDS 2006 SXWDS 2007 SX WO S 2009 SRXWDS 2009 SRXWDS 2005 3131W» S 2005 SS S 2005 57396 2006 SS WO S 2000378a 2000 SU 1W» S 2005 97896 2006 STSWDE ESCLDE STS BLCK/CSHMERE DRK GREY OR//GRY CSHMERE PlTNUM PLTNUM SLER SMOKE PLTNUM OLC( Yur FtSH Chice 1er Cadillac UWE FOLEY f Nrthbrk Cu Leee Save an 4ddfin 200111 CÛMPREHENSE CUSTOMER CRE PROWL rrdicl al Cnfidence OJCKSLER ehicle alue Prtectin: When yu lnance nw Cadillac well help prtect it retail vafue et tradein time n yu next GM vehicle BL4CQBLCK $47996 99328 2005 3151W» OUCKSLWR/CSHMERE $47899 99252 $0896 S1CKSMERE $41896 pg3 2001 8753W» WRREO/GSUERC $41186 POO 2007 SSMYD WllE DMOND CSHMERE 200f SS WD 99202 200881*58 SLNOROEN 99327 2007 ST WhlE DMOND $23995 99042 DRKeLUE $29995 2507 STSDS 9944 25573153W596 814CC $29996 99143!t101 $731W» S CRYSTL RED/CSHMERE 99333 200$ SSWO $34995 995 $19995 $19995 $19995 $21995 $20995 $21995 $2299$ $24995 viit u at2 tevefleycrn SLES HOURS MndayThurday DamBpm Frkay and Saturday OemSpat SERCE HOU1 MndayFrtday 7:3Oanißpm 082406E? SND STORM 8/451 WHE 0/MONO GOLD MST CRYSTL REO WHTE DMOND BLUE CHP/CShMERE BLCK/GREY PLTNUM/BLCC MSlP: $89349 RESt: $2500 S/EE EOLEY DGCC(Mt $5650 Payment Prtectin: f yu le yur lb well be thena fr yu Well make yur payment up t $500 per mnth fr up t 9 mnth $25896 $25995 $24995 $24996 $32995 $22995 $42995 CRYSTl REQ/CSHMERE $42985 P0093 2* 578 PLT1NUWBLCK $44995 :i i 99170 2008 fl 1/11901060 $42995 PR/Bl 200$ XL Pt701199 80100$ CRYST RED imports 99207 2006 NOSD *880*1» EX GREY $16995 8024G 2005 9MW 843 lc 0NEBhl1 BLCK $37996 90034 2003 1*81113 XJ lden PUS LUNR GREY $49995 10274 2007 MESCEDESSEZ 3550 SURGUHOY $55995 Pleae add tax title licene and$51b5 dfee GM Ttal Cnfienca i a anulacturerpnred prgam See dearr detail Saie pace indude appibe rebate and in lieu! financing Pñce nt avaible wh peca GMC flnanng r leae ffer y GMC leee r crnptitr leee wtha leat cntract inding bfre 11(O9 &3gibe prf dbae rnquiredat puithae N liadal required 00% PR fr6o mnth n new2009 DS Ecalade ES EXT and!ybnd $1667 per mnth er $1000 financed T% PR 1r48 mnth n new 2009CTS $2083 per mnth per $1000 financed Financing ubject t credit apprval and nurabi0yand in Pu f rebate flnance rate vile baed n cred wrtnne 01 cutrnrna detannned by GMCSrn8 cutmer Will nt quaj1 $7000 dwn payment atance when yu leae a new 2009 CTS (and exciudectsntavab WthO% PRr rnanulaclurerrebate Leae nly gdwitha0nancia ntitutin Deaierwii nt hnrpcng trrrin thiad Offer ntavailabie n pñrpurchae & ubjecttchange wthutntice Set dealerfr detail 011erexp(re 4/27109

DERBôR! O O O O Frd pot $14 billin l fr firt quarter ue le cah =LYLONm ::r MNdP ; Mich F Mrc fiç9ù*ttcrbpí$14 bdb6nt ree& *nd *id it dep4etd leu f ita cuh enth*iizn tht Bthâre ÓTEcabk weltget thmugii thheit ; FaduiditJttructuzaicóuby$19billln adding that iti likely tezcccd it $4 billin ctcuttingg*1frtheyeat "w ire ff t a very g tir1" Chief Ex it dent expect t eek an f çhe gvctnm itance th91 kecpingø ret f the Dedt ecuthe OftceJ ç Mul*fly (right) aid in a cn ThtCealie! 1 ference call with eprterl "S vie bclicvc that we The natin! ecndlarget atitmakcr will be ablet exceed that targcrfr the year uid it pcnt $37 billin mre than it tk in during FOtd8aidjtrnajnntbpj0 the firt three mnth f the year far lc than the $72 billin it pent in die fuith quarter f 2008 1 Chief Financial Officer Lewi Bth aid the cmpany i cnfident thatk will tw the dx*in ti u will make it thrugh 2009 withut needing gy crflmcnt aid Hc wuld nt peculate hwcvet g abut2olcj "Thi i a :cry very difficwt envirnment d NEW YORK t und like a bright dca Lat:week Bright utmtive baed in n dern bd unveiled the DE a toompg plugin hybrid electric n that it i lking t ell t fleet cutmer uch a buinee and gvernment agencie The autmaj gal i t prduce SOßOO vehicle a year tarting in 2013 The uinmate utcin; it hpe will be millin f dftai in avinga in galine and dzatically reduced erniaina fr fleet uer "We are ready t prvide the neceary autmtive leaderhip ur nadn i caithig fr7 Chief Execuj Jhn tcr (abve) aid in a cnference call with reprter Watex wh develped the battery pack fr General Mtr Crp firt eleciric vehici; the E unveiled the En Capitl E1111 in Wahingtn He aid the cmpany ha applied fr a $450 millin lan frm a Department f pbt a pmtltn a peetax bai in 201 1 While Genctal Mtr Crp and Chryler LLC have accepted $174 billin in fedcnil aid and arc racing tward deadline t make deep t;uts r ñle fr bankruptc Ptti wa the firt US autmaker t mdify it cntract with the United ut Wrker unin and trike a deal t make up t SO percent f payment t a uninrun health care trut in tck intead f cah The cmpany al cmpleted tender ffer t teduce it debt by mre than nethird (N lxqf*p Bright DE: Pugin hybnd vn gets l mpg Entagy prgram deigned t h4 autmaker develp fuele(fident technlgy Water hpe t beginprductin f the vehiele by 2012 and begin upplying t fleet cutmer the fllwing year He aid the cmpany i targeting fleet rather than retail cutmer beauc fleet cutmer buy vehicle "n preadheetc" li large quanthie which help being dwn the ct and eliminate the emtin preen in car buying "We feel there wuld be a rapid adaptatin Sand adptin f vehicle inthe tl!et SeCtOt" Water aid He declined to ffer an etimated pticefthevehicie Water aid the DE will run n battery pwci: alne fr 30 mile t that pint it will hinctin like cnvcnrjnaj hybrid drawing n a cmbinatin f galine andan cjtctxic battery t generate pwet He aid the 100 mpg igure i an etimate that aume a leer driver average SO mile per day ti tbpant aid the mve wuld tenth in annual aving f $1 billin Frd drew the lat $101 billin frm it revlving line f credit during the quarter and aid it had 1213 billin in cah a f March 31 Tht dwn frm $287 billin in the ame perid lat year Frd firtquarter l cmpare with a $70 millin prfit a year earlier On a per hare bai Ptd lt 60 cent cmpared with earning f 3 Cent a aliare fr the cmparable quarter a year ag Rcvcnue wa $248 billin dwn nearly 37 percent frm $392 billin in the ame quarrer f lat year a Frd US ale declined 43 percent On a pretax bai excluding pecial item uch a a gain frm it March debt exchange Frd lt 75 cent a hare beating artalyt etimate 13kven analyt plled by Thmn Reuter expected a $123 per harc l n revenue f $22 billin Bth called the firtquarter perfrmance _*tl (t glícr3 cmpaidr with Fttla ftiath quütr l f $59 bilbnçvhichledin a $146 billin l fr 2008 the wrt annui l in the cmpany lo6yrar hitry "1 think the im prtant cmparin fr u i are we imprving vcru the furth quaner? Becaue the furth quarter thmg were WtMN/GflTYtMGtS really dreadful" Bth aid He aid ctj cut and better pricing fr it vehicle helped the cmpany iarrw it lsc and he expect cwinued imprvement fr the remainder f the year i r uaw aanj miai ltìae and breaker are ueed at hme Pfl óurmm running thrugh a partcuar crcuti ftcu(d dnage lv _te* neteid a pwerenative fue pilced nt clrcu T much pwer wfl mçlt the lnnfianentbrenk(n thé thé pwer urge damage any paitthla why lt imrtáflt tö nevineth a ftiee thatexceecj the mcmmendetjampjag The eating f the fue i alway printed n ne end fm*e The fue nap int place n the fue panel Wire are either ldered in place at each end r ecurj uing puh cnnectr pwer urge caue filament t melt breaking the circuit Filament }f Similar t the gla cylinder but ha tw pinted endmt Eurpean cam crnewith thi type : : : fl$ FundhuTlO$t newe cw : 1 i : i i i r /k : urne r w 0% PR för 72 MOflth ïback with a en eance!!!:1 NEW 200 FORD FOCUS : Stk#P1303 $10989 Stk #S555 Sth 1T478 $16491* $183880 $14762 O LL NEW FORDS NCLUDE FORDS PYMENT PROTECTON PLN Le yur paycheck and Frd will make yur payment up t a maximum f 12 paymentsl* While ther tell yu there n credit available Frd Credit i ready t help yu finance! 42 : 173 rm 71 65 ati)lngpdc / j j e i ;g NEW 2008 FORD NEW 2005 FORD NEW 2008 FORO NEW 200B FORD NEW 2009 FORD RNGER F150 F250 Sucer Duty EDGE Stk #1(612 Sik W43364 Stk #H2335 Stk 1W276 SUc 1CO25 $11491* $13183* $16777 $20641* $22070 f; YER/1OOOlJO ñu :: WRRNTY Reda FLEX c%r r a ar 3 rh4 r i i M E 449a% P3 FMurnicng irnubue ra Certified PrOwaud ehc TRUK NS ß SU UNQEEd S1O000 2001 GMC YUKON DENL XLWD 29995 Leather 3rd 8w NavlaatlnW/OD ladedili Silt a29475 SPECLS 2008 OL XC7O 32WD 79 t_ y*9 NEW 2008 FORD FUSON Stk #R511 $13297 1997 FORD R*NGER XLT&m4 4850 2000 MTSUBSH GUNT ES ui 529W 4950 2001 STURN L200 SM4i 4950 2000 CHEROLET 510 EXTENDED (B ui rna5 6850 2001 CHEROLET TRCKER LT 4X4 4DR ui a2u47 6950 2000 TOYOT CMRY LE ur 2tu 6950 2002 DODGE C*RJ4 EX ui 529353 6975 2004 FORD TURUS LX ucwu444 7 *an 2001 MTSUBSH MONTERO SPORT 4WD uir 2004 SWER ON uc uiu T950 2003 FORD ESCPE Xl! 4WDui293t5 8350 2002 OLKSWGEN PSST CLX ui 5294U BSO 2004 MTSUBSH ECLPSE OSu4i2 8950 R! & w Mvatlngpc1c ;; ==irf NW 2009 FORD MUSTNG 2006 CREROLET 111fR LS uirm 2005 FORD RNGER XLT StL 4S8O7 2004 FORD EXPLORER X 4WD &2ia 2002 GMC SERR 2500 SL! EXTENDED CR 4WDS&2ut 2006 JEEP GRND CHEROkEE LREDO ui rzuv 2004 HOND CR EX WD ui 2006 FORD 35O SUPER DUTY XLT SuinS 2001 EXUS RX 300 WD uiiru 2006 JEEP WRNGLER SE uiiiz 2005 JEEP GRND CHEROKEE LREDO 4WD ui 53451 2007 FORD 150 CRGO l ui maa 2006 MERCURY MONTEREY LUXURY ui n8112 2006 FORD RNGER SPORT 4WD ui iuiu 2005 CDUC ESCLDE WD5&ui«a 2007 CHEROLET SLERDO 3500 (5 /aacd SitOfS 2005 FORD EXPEDTON XLT 4WD 2005 BMW X3 301 WDtjiuuuu O 2007 FORD EXPLORER EDDE BUER 4WD wi5 2008 MERCURY MRNER LUXURY 4WD u iri 2006 TOYOT TCOM lid SPORT CREW Cui5 2006 FORD ESCPE HYBRD WD ui ru 2007 TOYOT Fi CRUSER &ttiu 2006 FORD EXPLORER EDDE BUER 4WD &rm O 2007 FORD EXPLORER LMTED 4WD uiira 2005 NFNT FX35 WD Fi9e 2006 FORD F5O SUPER CREW KNG RNCH 4WD i 2007 ChEROLET SLRDO 2500 LT ill 4WD Biat Sit 529344 2008 OLO XC7O 32 aic37 2005 FORD F450 SUPER DUTY DESEL DULLY u tcaui $9450 $9850 250 11350 11675 12250 12650 12950 13495 13750 14795 16550 17850 18950 19350 19650 19850 20250 20650 20850* 21350 21550 21850 24650 26450 27250 27250 28950 41850 NW 200B FORD Ç TURUS flwhuel Driva Lather Pwer Sunr Heated Seat! Slit #FS8036 MDE M STKES? GET FOGWEN 11H11 JRWE HOME TOøYWMWJfOfl1Ot18!!kOrlcOm i r call 00 000 Sale & Service Open until 10pm! fl11bchas1 at t*ne8ad 01 Hwy 30 C uauie Mtr 9423 W LNCOLN HGHWY 25muu1efrømNaiervEel FRN KFORT L 60423 FORDFRNKFORT NCE PEOPLE TO DO EUSNESS WTH u wwwfordffranldrtcm B G 6 9 3 7 3 6 7 3 SSn*hjL O%J12UdS a O 0 Mgp&M =_=a "" 04* r 0 OTED ONE OF ThE TOP l 0 FORD DELERS 1N Th ÇpLÌNTR ER N ROW i 116 ) 1rllYf34n5 0!:_& NEW 200S FORD ESCPE SfkE321 2 ON RDUTE30 ULa5 i3out5 LlNOLNHWY OriÓ wewnttôd BUSNESS WTh 2007 DODGE (LlER SE i#2v3a 2005 NSSN M 2SS u ium 2000 LEXUS OS 300 ei p3454 2006 FORD FE HUNDRED SEL ei r5155 2004 CHEROLET MONTE CRLO SUPERCHRGED SS ei 52uit46 2004 HOND CCORD FXeirai 2005 CHRYSLER 300&rii 2007 TOYOT COROLL LE ec v29388 2006 UCK LCROSSE CX u im 2007 FORD TURUS SEL ui 2006 MERCURY MLN PREM1ER &tii 2001 FORD FE HUNDRED SEL StL SF51527 2005 CHEROLET CO1*U SS SUPERCNRÓEDS& tt 2005 UNCOLK 15 ec uaeci 2005 HOND CCORD SESu Ji 2008 PONTC GRND PRX GP5urnaa 2006 MERCURY MONTEGO PREMER e eauat 2006 OLO 560 25T&iw 2005 JNCOJ TOWN CR SGNTURE UMUD uc 5551838 2007 CHYSLZR 300 SSc t29 2008 CHEROLET MLSU Luiei 200$ FORD MUSTNG DELUXE CONERTPL ei urute 2006 FORD MUST1G GTec 53426 2007 MERCURY MONUGO PREMER WDticcaiu 2008 MRCURY SULl PREMER uc 155a152 2006 DODGE CHRGER DYTON R/T ticraii 2008 OLO 580 32 ui ur 2006 CHEROLET CORYTU CONYRRE 151 wtte 200$ UD 55 QUffRO5uir2n3 10450 10850 10950 11350 11350 12450 2650 13650 13650 13750 13850 13950 13950 13950 13950 14450 15650 15750 15950 16950 16975 17850* 18850 18950 19550 21350 26850 39850 49250

*wwe(3259 4i Brand New 2009 CHRYSLER 300C Brand New i S ER Thi ffer will never be répeated EMPLOYEE PRCNG PLUS blutely end pril 30 Dnt mi thi 4 Oflceina1ifetiniepprtjty t pifrchae COMMNDER TOWN COUNTRY T a Brand New 2009 Chryler r Jeep f with Emplyee Pricing + Cutmer Cah Brand New 2009 CHRYSLER SPEN 4X4 nan ew ii EEP t 0% PR Financing* + Big Mancarip icunt Brani r JEEP LBERTY 4X4 4 CHRYSLER REPRESENTTES ON THE PREMSES FOR CREDT NStNT CREDTPPROL : 4630 W1 95 St1 OK WN O _55 PDWnTMMNwnnTy j?ob) 42 a e i *tii*iiucm 708) 4 882 1 W 159Th ORND Brand New 2009 CHRYSLER SEBRNO Bind New 2009 CHRYSLER SEBRNG D*H Bran ew tsler PT CRUSER Fiva a*n S; *00*0 : : : ii e a e yr ON DSPLY 1 D jfl3 b F ;y C;»afl(J Clfl u i t:r( :: t i i t O NEW & USED TOPE LLR FOR YOUR TR4DE! y Smen Extra øbri» C1flLfl g g : W ) uur : ijeep OLHh1 R 11111 S Ȯ t; i r k;;: lfi( ir (i LETS KEEP S MERC ROLLiNG : 44 S STTME BUYERS NO CREWT SENtOR CTZEN SNGLE WDOWED DORCEO MRRED NEW TO TF1S CDiJNTflY NO PROOF OF N(OME SELF EMPLOYED %JS[U (R FOB EtRY L()h(E1 RD f CREDT 2005 tmyser r : 2004 CHEYEQ1fOXLS T 40«2008 TOYOT TRS 34Lutii1 8rc3tpii4* vt t&*rwdtaw; $ ji M 5 ti 2674 U1 pnmø D a* SLkS476 J U w**4ømwte On i:1 1995 NlSS*14 M 25 S 12995 006 JEEP UØERTY 4X4 a*mxw M1;t34tt9 On 13995 UM 16995 105 PONUC BONNELLE SE u «FORD EXPLORER XL 4X4!ZJ16995 i» jp RNßLER RUScON UWL*ED 4X4 17995 006 CHEY SLERDO LT CREWSS 4X4 2005 CDLLC ESCLDE 4X4 crm327 521 995 23 995 2009 &*k4 BUCK LUCERNE CLX *at«hbr wit tt8 UFM 995 m&ie Lade *U1 12995 2004 FORD F150 X SUPERCB 4X4 Th?1 12995 2008 DODGE ENGER SXT JEEP GRND CHEROKEE UMTED 4X4 2005 RESK LZROSSE CXl u;t JJ331P9 Qßç 14995 w gfm* DODGE lhrgeh SXT 2008 lhey MPl $ hwitk;t $ W WcQ Ld $ lt 5pd 141 4)& MW* 1wni R1 nadu tt ÍiWi l 2014O280 :ji W 1 2OM lmysler $ERU0 lonr1os 2007 CDLlC 0Th 3 :ftflj EEP WRNGLER HhRDTUP Ovy ) l;;t PlSST v STn C CRLE C 4 t S L 00000 t y t? ¼ ieep J;ep 423091 4630 W 95" St OK LWN ntive r CreditUnn t a1v Blck Eat f Cicer ve rit t!fl :r u MNCRcm Between Harlem & LaGrange Rd 0*00* Brand New 009 JEEP COMPSS 4X4 14995 $74995 16995 2006 000GE DURNGO 4X4 pøwmu1 aw332&øç 16995 200E CDLLC CTS 2006 DODGE RM 1500 QUD CB 4X4 ==r«i 18995 2007 0005E SUBER SXT 2001 1MW 7401 $q t jiai $ Dn1; J On 2008 MZD 3 400 NTHRk 2008 DODGE ENGER EXT "12995 ij 13995 $w ) itir $v ui 2006 JEEP UER1Y SPORT 4X4 20 PUNflC 0NNELE SE MFMW 3çP O& rj13995 2002 MEBSEPES lenz E320 401*115 ZOOE OUCSWSEN E1T S 400 J14q995 114995 2005 1100k 1000$SE SXL 400 ZOOS SNEYSER PT cruser ThEET GROSSER L4it!14995 15995 20 C ENOY 4X4 200e D00 NTRO EXT 4X4 201$ UCOU McZ 2006 GHRYSER 300 C 15995 J78LCK BEUTY 201M JEEP GOMMNDER SPORT 4X4 200E CDLLC CTS 400 v Mi WcijÌ pqf 5 w a t fl** &*U 1 2003 FORD F250 73 DESEL 4X4 2006 (111 COOPER S a F**Y " tr r Jj i Jeep 8821 W 159Th St ORLND 708)460_8400

g C{ 2 E C) C) C) w O) HMFC FNNCE BONUS il t!ìyu tlflaflcø brugli HMF 1)u?:(1acvan(age C PC4 HC r l ve*w100 000 MLE 7W ÇM4t w YEflaO 000 MLa CCkCC to a YER UNUMrEQ Pttnt POOQOF Slr C Cr4 UMFTED QuNmri" ÇBLEL H537 x 54O LOREN $ DSCOUNT PRCE f 0 e F YOU OWN UUND TKE N DDU1ON_ e _1 0 al r!xjwrftoo t Fr a Omilid fia fyu iø yur income wilt maki puf pl)meg (al 3 maßths flhta flt nuh tim HCO7 UM13 HUflDPl uranc Werk thng u yu can*th bi* t bck LOYLTY &Th l 4 e k %PR FNNCtNG LBLE 28 p 4_ 4 NE2OO9 1YUTDM EMNFR CtS DR : ( ; ï)(t)un1 lucl :i3 5 33 LLQULT PREOW1ED EHcLES RE PReD ThOUSNDS BEWW CELLEY BLUE BOOK! )8UZ yt Pic*i 5988 1f014 07 r øin 22 ;; C34 00 H k* 014&3 O5bfl$t11 12888 P418 O7ffiimiFtn 12 ::: CO)gG C77Sayj 14 to2344mat2rll 9t;: 4g7ß8 P401 O6U1LcU1 8 000Deø 5::: tuj*hm tl298$ lxo Z 17488 O3OMUZ WU Q46 12 t : 01 iy #1 8806 uti 07 Zua 10888 ro3 1400 i i v 15088 Ma2l$tipt %888 P210 Dl U88 lii kw fl : i 0 jjj ;1jJ Yj e 0$ E FORD DNTGE:\ lay WFeMáN)kL wk F?Rn WLL MKE YOUR PYMENT URT FOR Ynr 1998 Frd Cnteur #P12378 1996 Tyta Canny #J97808 2000 Suhani Outback Ltd #Z93505B 2000 Lncln Twn Car Slgnabir #p1 197M 1997 Frd F150 4x4 #P12369 2003Pntfaclbe #J07867 2005 Merctay Sable GS #93394 2003 Pnfiac andprtxs #P121159 2005 Frd Fcu #P12092 O04 Tyta SenB Wagn #P11975 2005 Buck Centuxy #P11959 2002 Tyta tav4 #93771 2000 Cadillac DetOu DS #P12399 2005 Ddg Cmyan SXT 418261M S t $15G5 $3995 3995 $6995 $7295 $Ta $7295 $7595 $7595 $7995 $8495 $8995 $8995 2002 Cadillac Oev! #P12250 2006 Frd Fcu #P12184 2005 Pntac )be #Z82623 2007 Frd Fcu #P12062 2T Che! 2006 Mazda 35 #93322 2008 ChrylerPl Cruer #P12235 2004 Ftd Expedltin Ed)e Sauer #U8309M 2006 Hyndat Senta Fe #P12008 2006 Chryler Pacifica #P1 2110 2008 kia Rnd 4P1210 2005 Jeep Gtnd Oberekee #P12277 2007 Frd E150 #P12242 2008 Mercury &and Marqui #P122739 2005 Frd htin 1tP12130 2006 rd J FUSON CPStM Buy FOR C C \ ; i 5 CC r Buy FOfl [: 1/ i/ # CERTFED PREOWNEb 1!! FRD DELER 111 LLWOS $11795 $1295 $12 $13495 $135 795 g 2008FOdE350 $9295 #P12296 12 Paenger 2008 Frd Fuin SE $9795 #P12123 2004 Jeep Wrangler $1O495 untlmita 4x4 #P12241 $10795 2007 Hyundalllburn SE #M977288 $11G95 21Y*lkwagea Paai #F83469 2007 Frd Edge #J97547 2004 MercedeBeni MUSO #P12083 200SMJtublhl Eclipe 20r #M97800 2005 Frd Sgertac XX4x4 #P12240 2006 Sbare B9ThbeCa #P12180 7 Paenger 2008 Frd ExpirerZil #P1 2351 2006 Ddge ChqerRl PPEOWNQO CREOT PROÉLEMSCjii Mr HOward 18474810435 1 $14995 $14995 $15495 $15795 $16495 $16493 $1595 $18895 $1295 $11395 $19955 $28495 RLNGTON HEGHTS FORD "Where The Cutmer lway Cme Firt" ç 8OlWet Dundeeflad reer ritiy ShOp CMtna ECtftrO i D Jut 5 Minute Nrth! dllefdmall OffRu( 53 n Dundee Rd SLES $ Ri! 7 _2111 _ 2 lili 9 rlingtn Height wwwahfrdcm Ji Uer plu ttx title licytie dc fee quaitied huvei Payment baed n SOO lwn i 5a tr 72 nì Frd dantqe Pian a manu(acturer prgram t qualified buyer w the purch3e f a nw Frd»"ci ee deaer fjí detail n Certified accruing f FOtd Mtt Cnpan pubihnu yearìy ranirt t: 2uû8 N vnw ale picl ft ilítiliatin )U1POeS nly Offer epr 3 flays frm pubiicaftn W ih Stee u826142 caim 7_ CUR 81 F TNEY PRk 8021W 159th St 929 auditineypar00m UD OF WESTMONT 276 E gcien 3833044 wjaurelaudcm ee U ca BMW 1564 W Ofden e il i86&5t&8015vwwbugcbbmwc0m FORtND PRK M10159hSt ark 88&502 bmwp00m RST BMW 466 W take St EmhUr! 888 wgy etmhursthmwm : L BMW OF westmont gden ve 86&385952? bmwfwetmntcm CM BMW 700 E 60)1 Rad Schaumb: g77wwathckbmwcm B u c nger Buick 6900 N McCrmick : d 866672599 wwgrneibuckcin BUCK 8425Wdt159thSt ark L 8663604575 wwwruacarcm Öad iliac cb Cadillac 2001 W iefemn St jllet 73t www8lluacbutcm : SNGER CDLLC 69òOt Mccrmick 8666799 wwwgrgercadil!accom TGE CDLLC 303 W ROÒSíet t d 88S81&5725 w*wtientagecadtaccm CK CDLLC 526MaJ Dr Sòumburg 9921wwckcadiiccm CDLLC 84 Wi59th St unlay : 8563604574mmlucaxm E FOLEY CDLLC SOON Skkie 51$ rk 86&3723654 wwwtevefieycom Çhevrlet NlGE CHEROLET 58 & Rute 53 rk 8886555359 wwadafltaechb\c91fl NTGE CHEROLET thgrane Ra Juet Cuntryide ut Mall 800%17609 edvantagechevcm Jacb Chevrlet 2001W Jeffern t: 8C5O76841 wwwbnuacbutcm: S KY CHEROLET 601 Ogden & 355 er Gv/lJle 63O96829 blllkaycherolotcòm DEMNN CHEROLET 1401* Dempater ark Ridge 847me1234 Ndxt t 1UthOrSfl General pita! wgwbtelemanncm tie Mtr Chevy Freit Park 7901 eveit Rd 8882943409 unfecheycm K PHELN CHEY *u Gctta See Jack Hadern Lyn 7c44240 Jkplßtancm ke ndenchbvlet 5333W Mng ik 773465Z0O wtewjnlketx1erncbic9go00m aie CHEROLET ite 30 &45 it 8902810769 zz CHEROLET 00 Sì4tem galew (888 5807799 B8 CHEROLET 288554Q75 Cicer ve 0( Lawn ejycm Chryler ancarchrygleñtinoklawn FERMN CHRYSLER DODGE 7601 N Cle ve Skkie (888) 7389744 wwwdr1veheflnaflcom HERMN DODGE JEEP 1601 N Cicer ve kkie (888) 7389744 wwwdiiveheniiancom i: C) Y cf NDER$Oq4POqD5639WOgdeiL RLNGTON HTS FORD wwwautrdcm 801 w DundeO Pd Mlngtn Height (847) 3463042 Blu KY FORD MDLOTNN ia 14633 S Cicer ve bllthafrdcm CURRE MOTORS FORDFRNKFORT Hl n Mdwet Rt30&45 rrcivrani«rtcm 86&YESDRD JOE RZZ FORD OF NORTH RERSDE 2100 S Hadern 1888401222 rluacarcm JOE RZZ FORD OF ORLNO PRK ald W 159th St 866337850 rlzzacam00m MCCRTHY FORD NC 1i400 S Pulak Chlcø7T3230?900 wmccathyfrdlncnet OROSSNOER GMC 6900 N McCrmck Uncinwd 866672599 wwgrngergmccm H n cl a CRRS HOND 8600 N WESTERN E CHCGO 7732747777 wwwcarchndacom CSTLE HOND 6900 W Dempater Mfln Grve (847) 9657070 wwwcatjehndacarcm EDNPLETON HOND Suth Side Ei Hn da Dealer 6701 W 95th SL 0Lawn HOND CtY 4960 S Pulaki Chc 773582501X3 wwwjirdacltyctlicagocn1 McGRTH ClTY HOND 6780W Grand ve Chcag 88S6i44422 wwwmcgathct4lfldacom OHRE HOND River Rd 0aktn De Plaine Pr The Lwet Price CaR 274b4 RZZ HUMMER 8425Wet159ttl SL unlay Park L 6&36O4576 wwwflzzacarscm FMLY HYUND 8101 W 159th SL unlay Park L 60471»409591w#famlytydfldBl00m Gralnger Hirundal 6147 N Lncln va LJnclnwd L8823M771 grningethyunda\em LOREN HYUND 1610 Waukegan Rad GlenveW 6477290300 *WOrBflUtOG(OUP00Sl) MCGRTH CTYHYUND 6150W Grand ve NPLETON HYUND 1965 RWer Oak Drve Calumet City L wwwnapletflcm 7068566500 OHRE WYUJ4D Rver Rd & Qakin De PlaiM Fr The LOWeSt Pilca Call Drect 88&4i9567 PTJOCK HYUNiJ OOEGOfRd Schaumburg wwwpatrickcamcom 8663144539 JGUR ELMHURST 490 W Lake St Ejrnhurt wvw4aguamlmhuratcom 8882876211 LUREL JGUR OF TNLEY PRK 8031W 159th St $6645112 leure8guco PTRCK JGUR OF NPERLE 1559W Ogden ve 6303005000 wpattc*3 Jeep SHERMN JEEP DODGE 7601 N Clera ve SKkie (888) 7389744 WddveShflem alt Jacb Kl 2525 W Jeffern St JUet 800630760 wwwbliuaebutcom EERGREEN tp 9205 S Wetern vechlca0 (806) ERKJ ever4re fl " GERLD lil OF NPER%UE 22i0 E Ogden ve NaOeMle ß3050 w«wgetdglc1t% JOE RZZ lil 150th & BOth ve Odand Park 70640300 dzzecarcm Lind PvPr Bill Jacb Und Rver Hinadale 300 E Ogden ve Hnda (L 60521 86&516a)45 iandrver00m Bll Jacb Land Rver Her Et 101W Hlgn Rd 90159 0685168035 landrvatcm LURa LND ROER unlay Park 1805097430 Nw Open! 81W 159th St %aure1endfoetcofl PTRCC (tt ROER 1559 W Ogden venepemie 6303005000 wandmvemnapeo?com BREDEMNN LEXUS N OLENEW 2000 N Wauiegan Ud 84729600O wwwteedemanncm LEXUS OF ORLND 5300W 159th 7093426475 wwwlexufrtandcom MCGRTH LEX%JS OF CHCGO De1len8TT86687 wem ereedy et JOE RZZ UNCOU4MERCURY 2066 Wet Ogden Nervl$le U 8887534262 tzeccm Mazda UTOBRN MZD Cuntryide 6060 5 LaGrange Rd k RliL JCOBS Mini 1564 W Oden ve NapeMle L 18665168015 wwwblfljacbmlnicm M i t S u b i h! GRND MTSUBiSH 303WGthódve Benenville 86O3100 GranØStUCCfl MX MDSEN MTSUBSH He Mad He Bad He at 2 SLE lcatlfl n Dwner 639606040 urra 68986OOO MaxMadSeflCO a Nian UTOBHN NSSN OF ENSTON W34 Cteceg ve 8474758200 wwtheautedam0m BERMNS MD CTY NSSN 4444*; iing Plc Rd ag 8886908659 ml&ttyrtsar00m BERMNS STR NSSN 5157 W Tuhy Nn ( wwetmlancom GERLD NSSN 1575 W Ogden NaeMHe63 3053331 188 & Orchard Rd N urra 6309070600 wwwgerdnen m KELLY NiSSN 4300W 5ue St Oak Lawi TOB49OO MRTN NSSN 524GitRad Skkie 8868382300 w*wjnatinnlan00m Pntiac Gwtnger Pntiac 5600 N McCrmick 1Jncl g«uepnuaccm 10E RZZ PORSCHE 8130 W 159th Stneeet Otlancl P& 7083642400 rzacarcm 4Z M* M2SWt irme t TieiyP** M MSO0 S7 wwwrtucm Scin BREDEMNN SCON iolw Demptef Perk Ridge (M7)6gB37wwJxedemannm NORTHBROOK SCON 53OFrOnta4e Rd 907343206 tjgrkclencm UTOBRN SUBRU 6070 S LaGrate Rd Benenvllie S u b a r u =g=w ChiCO) BERMNS MÓ CTY SUBRU iw rvng Pk Chg M55987467 ubewthle0oco411 ENSTON SUBRU #1 9u181u ir in llljn 715 Chicve Evantn 60602 i88&47ai g 63O9070800 aeadsubanicm Orand Subaru Yd Rd & Grand Me Bmhutt 63Ot64T25O Gradager Suzuki 5900 N Mccemièk LJnciflWOOd 5672599wemgtlngeruzcm SuziÌi OfEmhUr$Ì W Grand e Elmlurt 6353256 PLNETHOND 57 & St 30 MTTESON UTÓ BREDEMNN TOYOT 1301W Dempater?aLL wnplanethfldatiiflecom 17904t39 Pk Ridge 8476983700 ww*bredernenn00m Ne0b M e r ced e Benz RER OKS HOND 172m Tórmnce ve CHCGO NORTHSDETOYOT Laning L UTOHUS ON EDENS 1600 Frntagé Rd 56 N Br fl375000 cbletacm NrhbrOOc 810Ti$17 &itheunedelt00m ELMHURST TOYOT 9be Lw Prce Leader" 88&20&&34 ep://wgwelmhuruytftcob w Ogden ve LLEY HONDtn NapeMiiO/UTO 4173 FOX LKE TOYOT 75 S Ste 12 nd Rd Ogden ve (Rt 34) 6308515700 vaieytndaccn MERCEDESBENZ Of ORLND PÇ 8430W Fx Lake 6474970675 159th St 259600O J1ercedefdandcm GROSSNGER TOYOT NORTH u MercedeBenZ f Watmnt 200 E Ogden 7225 N Cicer ve Uncnwd 8666108606 malngetytanrthcm : ve 8663681522 mbtwetmontco1e p Ubeetyville TyøtøSClOfl USO S MP«auke Ubedynille 8713113817 w*vibettylletoyote NORThBROOK TOYOT 1530 Frntage Rd 8007343205 «thbmktytacm OK lwn TOYOT 4O W 95W St 800NEW TOYOT 8006398696 WWWO8K3WflOYOt&COffl : Odand TOOt*/SCOfl 8805W 1th St llniey Pelt L 7083426429 jandtetacm wodemsm PULYTOYOT 1O35SRt3L0MMdeSOUth f RL 14 crytal Lace 81545971O0 5476589050 PLNET TOYOT 57 & Rt 30 Mataen ut Mall 8006287012 planett«anunecln TOYOTSCON ON WESTERN 6941 S Wetern ve ChicO 7138847200 wttanwetem m utbarn kwaen Cunteyide 6191 jliet Rd 7053046500 (Only 1 minute frm Dwntwn Chicag) wwwewotchic8fldcofl Evantn 1033 ico ve 6478657600 Mt Prpect W Rend Rd 8473926300 wwntheutbamm BaJCOBS OLKSWGEN fl3iuelxa ve NWenfl$ L 188651B8025 w«gacwcm CTY OLKSWGEN ew rving Paik Rd Chlcng 8661766il wwwcitythcocofl w 0F ORLNO PRK 920W 159th SL 877444nß7 vwriandcm Sat SaMa 82 LUREL OLO OF TNLEY PRK 8031 W 159Th St 9683384583 SL iaurelvfv00(n PTRCK OLO 1600 E HGgn Rd Sthaumbwg 8476054005 wprlckvvcm lv

$3$5 11W RECRETON 5 RPLNES 510 flots POWER 51_t BOTS SL S 12 BOTS SUPPLES S 20 SESONL SPORTS S 22 RECRETiONL EHCLES Q S25 MOTORCYCLES SCOOTERS 510 ßOTS POWER f SLMON EQUPMENT rd ree prc dtr dwnrljcr ur $2O$3 324Th88rJ z E r) MOTORCYCLES SCOOTEBS MOTORCYCLES WNTED CSH PD ll Make & Mdetl will Pick Up Call $3O6ßO5fl 200 CYCLES 4 SLE 18QM244a hprmotrptnccm UTOMOTE T S FOR SLE MPORTS T 6 CUSTOM MODFED T 7 SERCE T 9 NTQUE CRS T 10 NS T il SN T22 TRUCKS T 13 TRLERS T 14 RENT T 15 LESE T 16 FNDERS SERCE T 11 SERCE REPR T 18 TOWNG T 19 PRTS ND CCESS T 2 LONS T22 NSURNCE T 23 UTOS WNTED T 25 FOR SLE DOMES T 26 LiMOUSNES T5 FOR SLE MPORTS 02 cut T Mnwl CD DS! Si199O 8884665S7 04 aud ß L 4 519995 9543799 herltagcadtllacm BMW 97 7501 ul ir UOvS PWL $4995 5&5O Car frm $5 Ptice mpundl fr Liting a»4737523 5C435 05 Hnda cord LX CrUi$ ll Pwrl Mrel S450 88S6365ST 05 Hnda Civic C CD The Wrk S90B63l57 HOND 03 ccent 2 dr 5mn lick CD BUy beautlu $74cc Cil 77392 HOND 50 Civc LX Dlt 4 dr Oren fus pt Superb 537 71375gng HOND 97 cc LX t Otn 4 dr CD full pt Super nico $2a* 77383Ç4 HONDS FROM $5001 Plice mpundt Fr Liting M»4737523 3436 SBOE HONDS a TOYOTS FROM Scmi ny çfc rnpjnd &RpO!ctjr Nian Ct & mr irrn 5500! Ñr liting»6oizt litt 1215 HOND 94 ccrd EX nt b!tk 4 dr luit pwer uprb $1700 B47ne50Lj HOND 92 ccrd Lw ri hunt nciirrl Lk gd $2500 t 7735578?154 OB Hyundal Søflta S12759 9664l7950 rfllagecdlltccw 05 Hyundnl Cvc S/P5 02 Hyundal cce OS Remt Trn Pwr Prg $4990 B883& HYUND 96 ccent 2dr nul 75Ç m tr clean run grut $2175 7730191502 Mrtn Gre HYUND 96 Dantra ddr wagn in cxc try clean S1 77a5905954 NFNtTY 92Q45 LSed u cien new brk/te4j0tt 5310 crs nl! $5tYJ3 77331c12050 * * * * * * JGUR 88 XiS iz 7OD1 mile elderly driven 2cer tre! ffer 773448635 09 Kn Snectra #P6793 552995 DG40713$1 03 Kn Spectra 4 DR Laded! S29gO 88S63&6557 Mazda 08 CX9 DP14731 $19 995 at $340/M CL NOW! Maadn 076 P14753 $12995 r $224/M CLL NOW 88&695?3fl 07 Mada Speed 6 Turtrt Btctrt Lw Mit $15995 635950250 grandiburucm MZD 94 323 Hatchback run euceilent /C wrk gd $11 7733TO81n MERCEDES BENZ 9? E320 Black w/cream interir Under 15G 5815X1 77Z53172$21 MERCEDES BENZ 96 E320 Strm gray tatker n! ljtuç mi 5 dc CO player $3Y! 7734255213 MERCEDES BENZ 94 190E Ca ron/tk gn tran tp $1250 TcWd2&3874 MERCEDES 87 560 SEL 1 wner 4 dr edan treaty in encllent riginal factry 000d(tttjn pritine leather tir finet OS tu hirn! in the Chicegland tero Garag kept $5560 Firm 7737013737 Mercury 99 Cana kp4749 $39S Cr) NOW! 8885957313 Mitiablll 08 Lance $2078888 613995 r 6207/M CLL NOWt 8886987373 MTSUBSH 03 (lutant açettnt Cnditin 7c mile 4 dr $4560 7733457047 MTSUDtSH O2Oaant ES 4 dor 35610 mi 24L white pr! ner Rd c&rd $3460 6G5464 MTSUBSH 93 Damant Statin Wagw OStO S 06k mil clean $1575 7136881602 Mdu Crn Oi Hincan ttmi #35041311 $54r95 Clt 885775744 Glendale Nierrn cm NtSSN 05 MXM SE 5 eperd grey unrf CD/tnlt 144K ml Garng kept 6tt2925xJ31 01 Nan Murtlm O 57959 D64037908 hrttgectdltlnccm NtSSN 99 lttnta 4 dr 4 Cylinder aut il pwer 59K $3960 735O35&12 NSSN DOUtlma 05E Whte 4dr Sunrf feil pwer CD/Cntt cld C enr nic $235077388313684 NSSN DG Manlma Sunrf pwer Snt iir: $2250 633670 3282 Plle mpendg fr Sat Tyta Camrr 1550 ene $1500f Hnda Civic 1999 untr $j Hnd Tyta Niani S Mr tem $31X3 Fr liting 59X36O124 et 1213 ói Plice mpuritiul Car (rm $5601 Fr Lting 1874737523 XC436 07 Saab 93 20 Turb $55595 D6463?9t53 hdtagecadlttaccm Seln 09 SD 521042M $1539$ e $278/M CL NOW 8885987373 09 Subrn Legacy 4 ChOOU Rf! $1O495 035580250 grandnbarucn 08 Subaru Outback 28 3351 Slver ut! $14995 3O56S025Ogandaabaucm OSabare mprean LOW Mt Grat Mtt $12995 6359$0250 grnndaulnrucem 06 Suban Legacy 25 at LOri Real Turl $17995 63G8160250 grandubirucnm 06 Sbare Outbck Sliver Lw Mtl Cleant $14995 63056513250 grandubncum 04 Subna ßut5 Turb Minr Lthrl i2$95 6385680250 grandubarucm SUBRU 99 Freter L all wheel drin lw mile green full pwer Run uttardrr 1 wner $2750 7731831304 05 lyla Malela Luadd S Rctlabte $239908885365557 03 Tyatn Cmte $8959 566463790$ hmltag550ttltlccm TOYOT 00 Cumey LE Sit ver 4 tc OCO full pe CD caette celti t Outtand ng $3750 Call 7735090251 Tcata 97 Carte #t34842a $3 985 CLL NOWt 888657313 TOYOT 96 Cmry 4dr CO galet cl 179e lk & erut gd $2050 77363tt64 TOYOT 96 Crlla 5 upti tick hill 322K pnd cand /C $249ó 8335626504 T9 NTQUE CRS uttn Kenty 54 tu 67 and ther Brrir Eur Claic rum wantedlt)30 t 1560 ny cand Bb 75048883j3 CORETTE WNTED 12531973 er9 Cndtin Cunepetitire Duper 13655Or ctvettbtiyercarn CHEY 86 Caprtce ri 22 rim 44e alt pwer Clear Oti tailt $350 000 1734990159 CHEROLET 82 530 Pckup 2 WO Freine p retred 3 new $3 h Cell mrning 7064255601 T10 NS Crk frm $&Xt Pllc mpundat fr Liting 473753 00435 CHEROLET LS tr Crea un g4 mile ir ccellcnt gd cnditin clean title ei thing wrk S2J r leni tter 79792905 Chretu 06 Epre* 1P14777 810995 r CLL NOW ù8s698731 CHEY 03 EXPRESS 3500 Curgt en rth randy uhrelun rck 11610 run 84 $3856 ODO $062032757 02 Chevy int fprer $4999 Cil 8885762244 GlendabeNiancn CHEW 95 tr 7 pngr it pter 153K mil entro Clen $2175 7730881962 MSan Grve Ctrriter 06 Twn S Cuntry PP4853 eu Chryler 03 yager PP14 $7395 r 5127/Ma CLL HOWl 8886957313 02 Chuyler Twn&Catry l8720$5/ms Cult 8855752244 GiendalNicm CHRYSLER 98 Twn and Caty LX 7 Pa red thr lull ptr harj mus n $2500 7735072275 08 Dudfrd Caravan $12995 DO00EOCRNSE Burgundy 7 panger ally cld a/c mt neu $2160 Cali fl350513$5 DODGE 96 Caravan SE 4 dr clean n runt r centa Mat St $2250 773764in DODGE 95 2500 Lw true Run lk gd $1W Oh Call 1739574764 Frd 08 1 Pngr ari #P14779 $16995 r $264/M OLL NOW 8885952113 Frd OB E250 Carg 11914775 516455 r 5285/M CLL NOW 8885987333 FORD 08 E3SO XLT Super Duty Pnger factry Order Nciret twed r hauled Rar cenr N hitch Tnted winclaws 12 pas5005nr 1610 crt fled mi nlde & utde lk new Gar kept Factry weirran P 10CW Michelin L!) llrn Sticker price new $32050 Nw $18xj 1736032777 FORD 05 WNOSTR Mint Cnditin! lin Gd! S1l/0B0 7734998776 FORO 2001 WtOOSTR white 7 paenger cd lull pwer Nuct Mat t $WO 84747561331 FORO 00 E250 Cng an ladder rack i wner 71* rg mi $Y213 31237615133 FORD 00 Wlntar Muer 4ar 485 red en cued SlbSOOba $47791 ià FORD 97 250 ExitS Whle Caig llar a 234k mil lutt grat $1575 7736191982 Mrtn Grve FORD 9$ Clair Wagn 15 pa ltti wrtili new ivire Silcm 011O 7504211565 P3RD 115 Wtndtar gd cndtin x Drne $1QSOOBO ñ3297232 MERCURY 97 tltqer 7 pa ncellent cnti 1735035902 MERCURY 97 illager OS 89000 m blue 7pa tell ptr run/lk etc $1 7732717236 97 Mercury illager nn grealt ne etire! $9007739381870 0105 00 Slhuette 015 nsto feather ril pwer Cld nticycø1grgcu $2150 13571 7236 T1_t SU CHEROLET 00 DL2ER LS 44 black 4 dr full pwr dem great ut $25l0 7135090215 CHEROLET 95 Taler 1500 LS 4e4 Black 2 dt lull pwer flily CD tlnety $24W Cult 7735636642 ChEROLET 94 Blauer O W30 44 gd bdy drive gd $1050 7064361824 07 Chevy Trltblae 5*8598664537909 tretlt000cadlltaccpe Chevy 0G Eqlne* "Secnd Chanc Fnance" Oecd lb? lad Credt? "24 HR LON BY PH0NE Ott (773J3486263 EZ Credt" 1*1*1*1*1*1 Chevy 04 Trlblazer "Secnd Chanc Fnance" Cat 3ubl Bad Credit? "24 HR LON BY PHONE" Dr 1773)3485253 EZ Cretill" 01 Chevy Bl 4a4 0P87544 $4995 Cult 88813152244 GlendaieNiancm CHEY 01 BLaZER aut 25 1 wner liii $3965/b 7067151997 CHEY 01 Slluerutt 1500 rely metailic 531 CHEY 00 Blazer 4x4 4 dr blue vm traed Cnti $3160 ò36405544 ONChiylr Pacfca 3lp6801 612995 86&4O71351 OS 86640713S1 Frd 03 Exptr llt atl Frd 03 Eplrr llt Lugg Rack Kerte Entry 5559561183555031 Frd Eap XS $4995 8064457531 heritagecditlaccm FORD 99 Expedtn $896 clwn + ni $89 weklyl Call Sherry; 03D80393i FORO 99 Epedltn XLT 4e4 White lull pwer uliy grgeun must nel Sl8Xt 7735834942 FORD 99 Laplarr 4a4 2 dr upn O Mini crtei il pwer CO/Can un rl new tite nllt rit Rurt S lk cxc $4250080 Call 7739503370 FORD 94 EXPLORER SPORT 454 white fd nun rf mut dccl tíió 77$ 5836642 06 CSC Envy 5*759 86&4378 herltagecadlltaccm 07 )lyundal Tiburn SE SUZU 97 Rde 4dr 4x4 laded 147K Sund clean 51650/h 1737433 Jøp 06 Org Chtel $2195r37 p 05 Uhtp Sprt 4a4 Jeeherkee 995 CLL HOWl 88957313 JEEP 97 Cherkee 4x4 tully nutted gd Cnditin in ut $285006084745871168 JEEP 97 Craint Cherkee LTD blck n blnck lk ruci 11k nw luury ce celti /C&ltt $25 7735209695 JEEP 94 Oread Clrrbee LD Ed 44 trd 4 dr?ttayrr fuit pwer mut ci $2X61 7735090275 08 M Sarete #P6800 514591 55041373353 LNCOLN 9g Nnlgater fully lcndd ddven rk nw mw mi $55W 7733757999 Mtubh 04 Outlander #P14834 5499$ CLL HOWl 8$8697373 03 Mtubih Mnter Rd Hd SceNt lls $12995 6306650250 000ndubarucern it Mitubihi Mnter 58761854955 Call 8857753244 GlendalNluun cm NSSN 00 lurra 4 dr red aut 4n4 CD mmaclat lii cic 7735035802 NSSN 9g PTFNOE1 Stick 44 i wner 1104 $425300t 7502961957 NSSN 93 Pathfnder SE 44 black unrf 0110m full pwer nice $16w Call 847ti8395ti Oldmble 00 Brvada 87444 53995 CLL NOW! $586957313 $5001 POLtCE MPOUNDS! SU Truck frm $54X31 Fr Uting a54737523 4351 06 Saturn e Silver utmatc $12995 63 S$SO250grnndeubarucnm 08 Subrn Freter 4 t Cht $14995 6365955050 gtnerdahamcum Tyta O? RauS 5P14157 Sil 495 nr $303/Ma CLL NOW M&6957313 03 TOyta Sflanncr Perfect Sd Gad alant 512990 5586365557 TOYOT 90 4RUNNER R86 4x4 lver ht unrf full pw rr allay CD nic bdy ru perid $21X43 5979539633 T42 TRUCKS CHEROLET 53 3500 lull nc pckup 4x4 ettra cab white CO Slum grat ceullir $1102 7135030275 CHEROLET 8$ Silyadn 1500 Lnadeli autumatic Sl t bdy 5121X1 8477200733 Chevy 01 510 Plc}cu ut r PW/L5810 i;6 :: t 355503t CHEY 00 2500 Pck up Wtrite mey rd cand eneulur cab 14510 $550 633h3$484 CHEY 7$ C3O Dump Track 4 pti uch lre nic nut ci $5000 7735836684 DODGE 01 Ram 5500 Pckup all prr B OhOttbti 884 ml reg Cub caro cle run lk like ew Priced t Sell $5075 7730151982 MrtrrGrnnv 96 Ddge 1500 EXT Cab #3002406 52995 Call :m: 6762244 Glndalef4ancaty 0000E 965919 1S0OtRME 511 Pck up red full prr ally CD nce mut nn! $115) 7132717248 FORD 33 F150 XL dl mint cndtn ndter $4831 ll 7a4336777 FORD SS F190 lw nriien rneny tr nw tirir $1350 7739914720 Dp Frd 90 Ranger XLT yc US ytit Frnt Bnnctr 51195 BltSl55it031 $5001 POLCE MPOUNDS! Truck and 4n4t Fr Liting 8374737523 e3366 T13 TRLERS SOUTHWEST 1 13 X 1411 Enclcad Carg Trailer Ramp Dr rr back Sd dr Tnndem ally 2 516 Dall Cupler $3110 7507507620 T19 PRTS ND CCESS DRUThS BLDES RMS 27 w/ new tirc ery gd cnti $ll50tr 7739576764 WCKED RMS St fr $650 were nc n a Buick Play Cell 7736052112 R1M6 TRES 20 nch llure Stlne rnt wheel driv $1150 OttO 7736751296 T23 UTOS WNTED (k i cah NOW! 700 22000 Ch n :l hrl Fr Gd Car! $400 fr Beater C 24/7 7732403077 FORGET THE REST PY THE REST Fer ail Cr & TrUCkS Running f nt i Day 708975035 D Yur Car Stp Runnng? Need new ltanpelatiun? We Guarartlee $11130 fr your tradall 04 car avait free twing w/putctte 99% appemne; Free CreditCheck 63345icgm Mt Cah OuNaeted Fr Yt DCO!?56965J4t1 G6 Stiffping frm the COCOSSOn? N fld t farhi SO Stmulu Man la lierel H Puy $500$25000 Cah Fr gd runnng car r truck 24/7 7087989860 / GET CS NOW! W pay the heut fr Juni Cr Truck! Free Same Day P/ll 7006585018 / 7001954835 NEED S w? DONTE YOUR CR la SPECL 11105 FUND Help Olubted Chldren With Ckrnp anti Educatin!ln400nner5 OK quickt Free 1wilrg Free ttvlftllel echr Tax Deductible Cull 14964483254 bey Junk Truck an Cane w/ er w/eç title! Runnng r Nut! Will pck up TODY! 7002898490 WE PY BG CSH FOR JUNK CRS PCK UP SME DY 7219346212 CELL 7 DYS Sy Car hum 5298dl $0 Dwn! 36M @10518 Fr Liting 8034737523 n60l WPaYCalr Fer Carat 3555031 T25 FOR SLE DOMESTC Sech 08 acnue CSX 0P14432 51799S $313/M COE HOWl $586987313 07 Buck Lcarn CXL $185958064487537 heritagecadltiaccm BUCK 04 REGL very clean cur 713t mile pwer nub leather remt tart CD/ Caett 485) 7737424913 111)1CM 03 Century 4 dor 331 tirr aut clear very gd cns mutulil gray $3453 6331055464 BUCK Ql LeSbr 4 dor actin laded like nw garage kept 1 wnr elderly wned ljh( ml mut ll $5760 312450g227 BUCK 99 Park vne all pwer ptin rrjn a lk; gd 5295) 7j381884 98 Buck LaSab ddy drven ilm gmat StOc li 7739905638 iitecj4 GROSSNGERHUNDCOM NGER GRND HLLE NG [RE 0111 TU BE #1 ND CHLLENGE YOU lnd BETTER DEl ON NEW HYUND w 21M m ENTS3«::" y $Th c$ c 72 t w fln SOt*T 14995 11118191 ÖjPÑDNùS1RlPPtfl 1wTHuTB: age : S2OO CSH*E114 TZUSSt NEW 200 SNT FE LS $1 r; 795 i4l33 ;iqwppeø NOT STRPPU Wl1li UlO WMR 1000 g1 HUGE SELECOEW 2000 FORD TURUS01 2001 MZ82SLXSMS4 2003 TOYOT O4OUl 2003 NSSJ* MXM SEl$ 19LEXUSRX 2002 NOO cil EBM0 $7w 2004 NYNO SO(T a 0l 2002 JEEP L*ERTY LTD 4X4 S0 2003 TOYOTc*iimz 2005 POlUC $E118118 FNNCNG FOR HYJflDR RdOSPY1JN5PJ S Gli W EXTR 5OO OFF! r3q$4ooo FCTORY REBTES e 15OO OWNER 2 LOYLTY lifetme NEW ND USED WRRN1Y HO PYMENTS ill JULY3 3 DY/150 WH EXCHNGE POLCY : HYUfl0R : uranc merica Bet Warranty 1CYcar/100000Mi!e POt86fbhl Limited WitnPnly U6 deajuml75d KHtJ4NTYd6tll Weve been her fr8 utvme + W back yu fr a f HYUND N iù Sia 40m(mø w a ELJTRt3 r 909951154070 iuuñpi: t rnppim 15OJ ao% cul* _n_$t TM _w 1URON u 1539511118103 nu fquppw NÖTSTRPPD1 MSRP8 24425 SflE 9OOO w zw NYU GENESS 38 B 2899 :Efluppin;Ny:STÄPPD WtHUth br1 $i_ : lisep 0 : 3755 t u1(1t/86lsl&2l OF USED EHCLE RQtD ttunds SNT FOR EERY BUDGE! 2003 OW CC 1& PL :: øc$fflcosltssm)l Z003 MERDES E320$ff341 MM 2O5 $RYSEfi 3000$Sfl UMøltS 5 %_l73 2005 YW E1YTD818W zee 9680E 2001 CDLLC DTSMTh $9995 20$ NilU11 G35 0LM ZlWS z:: i 2 EUS RX3:m WD87 %6 Lrn1 z WGEDS ML35OH) $3 2007 CHEY ORE1 ZO6SlLl 5S6 lfl5 me 86623 84111 1147 N UEOU E LNcOUW000 N 71Z qrìu!jerlufldaicom h OFfERSYOU DY/i 5OM EXCHÁNGE OLC u1 ;7/) ":u;;5uu FET WRRNTY0 ÖN1NEW0&WSED ç:d4rk9e2; 04ltWt w t tt rl MO 55 ScON t WW r crrarc 1532O S16420 $11610 7225 h Cicer Mia Lnculwt ursuofs010 cni 8O661O2hOh 9 0 r1lr rena areri r ree rna TOYOT SCON NORTH iciar MLMLE F56 DL FCTORY FlmaNGt «w TOYOT TEl 301 L iliur $12495S119 nw ON TOYOT coull S4395*149 : 1$2uR1*kkl ZOOS TOYOT MT1U 121995* MEW i1t j r $1499590$159 TOYOT CMT 117695*1169 i NEW zim TOYOT PWS Ç_il_ll 4 119 995*1239 MEW 2009 TOYOT Eu c 289 í:_: 0LtilUL:ir f OR fl1t3 n CR1ST86$*ztu*W86k 88Mmitflaly 1501r ktdi1m h u_ f_? 8* M 1T86 ntt 99ta9T5SM i 8811T1T5U4454 nizru& il FNUPU86SE mi*s2r llfls 1288115613M rertre 1S STO 86 N EM$8M itah YS 0cS0U l 86 NSM *818601 nu 13 ttmt8 JiF wire "m 0*1 fsted UT U 000ai8flfl5 1S156$U*CYaenmnu& %SS Ota5157 1l095 192 13NS fl86wttw4x4 rutm = 2 T91 S*mrt l5d5 885YaL86al reran 11364* n*j NUNM(Y i 1lD86TL taran N S99S2ß2 OEO1t5 329 W*1 iarinr 15l T1Dø*81TøT1X4 mu* m 2007 TOY SS Nul MM 1910 Pi rabt 15 y N TU$ NS ri YYaTl9vl *a%n Z07" 22Bß5384 $ nnmu Z4fl Weve ben her br a twetm wd back yufr a 11541mal 85661O25O5 8Z 7225 N GcEJ E0 L1COt*OOO L gringrtøvtanflhçflifl a

a 8cg EXPERENCE THE RLNGTON DFFERENCE f j WE HE THE TOYOT YOU WNT WTH 771E PYMENT YOU CN FFORD! 8 FOR 60 MOS ON SELECT CERTFED PR PREOWNED TOYOTS! %) DOWN! NO PYMENTS FOR 90 DYS! g C g 3 z pecial Pñce andbinef it mimé MneySaving Cupn iicuted Ì3nSite Rent a Car ree Car Wah with Service LC n OurSeryice Department throlder Car reé Cffee Sft Drink and Bòtt(ed Water un Service CliiQn Cent UHf Phtcpie and Fax utrner Fir Card: 90 Day Same a Cah rèeradide itance Twing frlear ave n Ga ante Tire with Lifetime Nitrgen Tire tatef the rt Service Technlgy& Training xtended Evening & Weekend SÒrvice Hur ee alet Parkipg Delivery : ärvice RrdReiÌered With Carfax 935 W Dundee Rd øuff& Grve te a U4 kfaf $150 r LESE FOR ONLY m nawth12k y$25pne 333$ ktd & $1w Lb $0 txny t On NEW 2009 TOYOT COROLL LE rn WC POWER W1NDO4 tcx S1tERNO cd PtYEH M/FM STEREO RER DEFOGGEft SX f25417 LESE FOR ONL akön bue 36n*)fl%th 12n 1m Wd$25pn*g a1atwrj e 8 $150 c tee $0 wity dt On LESE FOR ONLY P/m** kr$3 FU36flûlUbfl1 1nU$25 n xi $500 &xtá&*i r lax Oe ce & $150 &c fe $0 &t On rwnd aitse deaic% la L TOYOT SCON TRUCKS TOYOT mving Frward WE SPEK YOUR LNGUGE: SPNSH RUSSN POUSH KOREN GREEK PUNJ GERMN UKRNN URDU HNDi 8882974652 rìngtnutgrupc Yøun LOCl TÖOT rleet DELER Find ut hw yur buine can becme a Tyta Fleet Cmpany Call Dan Wll Nalinal Fleet Sale Manager Tday 6882071652 3MT1»MLEUM1TEDcOMPR9ENS4EWRRWY 7Y4R1cJELM7w POYPJRJNWRMWTY 7Yf»MERODS1DESSSTNcEPL4N 19JPOffiTOiL4LJrfSSLMWcEN$PECflON 2003 DODGE CRN 8991 2007 FORD FOCUS ONLY 8k milel 11990 2004 TOYOT CMRY ONLY 48k mile 2007 TOYOT R4 $19991 Fa;inr Frd Call Mark a at 8479021990 f TOYOT mving frward % c=irn 2001 TOYOT ÇELC 2005 CHEY MLBU )490 2006 TOYOT COROLL 12990 2006 TOYOT TUNDR 19995 TOYOT SCON TRUCKS 935W DUNDEE RD BUFFLO GROE WE SPEK YOUR LNGUGE: SPNSH WSN loubl 888297N1 652 KOREJ CREEK PUNJ GERMN UkMNN URDU HND Ptc Ne1tax leim i $5O d fee M Tyta facy ibat *d 49% PR fmdn w 60 m a ct CerOed PieOied wic ted bwt aith arçmved cit 4P5Om $13261OQO lnat "On elect mdetø 3dmirtta e e L e

i clean / t z E C C Q C C u) FORøO BRND NEW NSSN SENTF4 : Over NTONL TENT EENT Zrinreaaiabe at hi ri (ttal due incue BRND NEW 2009 NSSN r t LESE FOl ONLY: feae icepf in riti LTM 2009 NSSN t F 0 e a e S a UN C tt Çli n»1 ç 110 f ce na w13 iøcl St iqt w $fl*o z72a ia PN$ tm MNOO% CD møcqtqtf demi nide &u lt L tm lki em ze CCUJC tunmf thrnte wt$&$ lw nlettraclfl heated tetß $T9O 84?3O741 CDUC Slll3T$ 4dr bldl n blicn i21k tun rf hmed temi 4 ó im& CWpc EWwdt 17M $N6 c*a w W4Th13 CDS_LC M Ritwcd Um UCÇ4bac& biittmdy 000 TT34677 pr n331049 CDUC M $n* tte wofl t% ttoter eat gd ccndltlun 1 mile $z4 7331111lX3 e C Deil i wner gae kept ince CDLLC new nflemitaf mktt cnd in urin hme mu1 ell 100 3123&7 C)fffl clt*pt" frm $6%" CaO Pam 6308939318 CHERuUT LT SR 4d c cand a» mi $4000 7Th3490047 CHEROSET DL tma 4dt ex $10x00 111cc nw hiny G $3500 7t848400 cvrt Dt MUG*J S Runt! lk Gut CO cian G $2750 773301911 CHEO*fl 19Malia LS 00 mili blue4 dr 1650Cl 111500f 50051 Cmtti iet CHEROlET led aut lk xl runt greeu SK ml $4 Cal mrning 14256001 Chevy 05 MaSS 1p14a13 513 995 r 2JM Cti ROWS MeO13u 01 Chew mpala S Simi Lcit like Newt Gilt Ml $ FçdExp4ß11ST11<l8 184e 707178G ONbY S dr mho edi cr50dr nt $8tR05 fl3435etn clie SMeNCt 00 CHOY NCOmMO Cnvttthle mint cnditin 4th actual mil t wner Like brurid new n 8 ut Gmre kept $11050 MUST SELL 17506 3c*Ceca $180 8cn $7W WçadElcuit WW 4031 Ñ Eitn ve 047$ ted Ce ClvleiLX 1 $ZSSB ee64o143 clwntptcrui ie$tz*i N OBCreaøre c*aj cenm 14123 $*N5 i0 $8701MO CLL N0 731 rec CHRYSLER 5ebdid OTO Cflveçt$8e flan C955 Ce! Oui &tev 1øwner1eimL 16400000 141T11 PTCnW Cam MB6 Giunm c*a w Ddd 14T14 CMLOW M4814351 M0895fl33 /11*1*1*1*1 Pia 1BaeM ZxN Creea Rimii POS 14 r t*nly PORO Tíe fl 71050 ml belie it lit tufi pwer CD ibe 1 lwu1 ) 11J907L4t0 temceuiwo blue4 dce C51XpT50 ee FOR07Wuk 2*mut 4 ci 133kml lk gd run ren $75 fl3et19 Mrtn Grve ridi ex eeuuimi ifed nice! 713271T46 FORO S Teem dii wtiite 4 dr nti eacelient lull pwer $7WT73550ò1 FORD 93 Tn Wegen P000UiuuiuOL mamn exc medi cried C tt detal FRD CORT 01 S50aU$O080 FORD Crw let*ql5 111 tkiciui Cnthiertul $7wM47B87 incol $4 Twn Ca Mani NEROMY QO lntier tirodll vany miadile 7738414891 NEEDCR? $150455000U01i MPOJNOS Hnda doxel & Olin tuapcans NSSN 00 Ml;nia SE ieatb er un rf lcw mile at cnd 1 01115 50OtWUGL 3& 4 411(1 Lull Ou077n : ODliciNli an =gc Mm Rßp1 1$: : 7132717246 tu UiUli $O57931 tld$ P3 PUce knptlndt Frd Chevy t frm $S Fr UUria $0473152303443 g Pmlc Oiieid Pum 4dè fthm PONTC W Oil M $ POC 1S gun like new leather bit thslbo 3134312436 pnriceouipd* at ladd null geat redll t5d PONTiC órà3adprlx P01111*0 aemidim 58 mi pwer aun tf er $3 050 7733U3O Gl Pcnitac Bivieville My $408 i Ru*iGeett Fór utirtga OuXi47375fl xc445 BTUM 04 li 50Ux5 mile Gld 4 dr full pwer 2punre vailahla a with $2Oltal diia ntude 1tpaynei ;:4J lee With apßedtrethl t iehate and inenuviie i D 60 mnth 9%PR rfl mnthu B% PR tr 60 teqlred Mayba nlieu 01 ther dcunt r ninivel0%leí 12mft i ( K( N RLNGTON HEGHTS! S i O O m g Stck1991 19410 2vr TlO vailahe athi price 19 mnth tenne with S2O9ltal de nc tenne icepun(ttale innen ini nymentand SO ref uniahle nererilyepnil tl i1h i (t L t 1*1*1*1*1*1 Chevy 06 e50 cln Gd M? 550 cd*? "24 H* L0*1l 5Y pr DW (fl3)34$3 tz tit" /*/*/*/*/*/ Chevy 0G Malibu 050kb? Bad Credit? "24 HR Wit BY PHOOOE" De(7Th3a4333 ZCrdir Chevy 05 lmp$a Cae HaC Oued iöl Bed Cedit? 241mLONBY PHONE Dfl3)N tzcm CKLY 04 CavaSe lw mile 4dr gld clr CO gflecu $3tL 17309O75 03ChvCi1lie$ t31o150 $4 9 CM 1067W244 Olnd*Ni3Ctcm PONTCOBGxadPt* Excelleal cnditin fr/ut $8150 173207 000GB 50 Near UT 70 mile 4 dr Yellw 000GB 03 BTRflJ R! red lathee eat! M lieu c blt flits Brett $331 000 fl384o Cad 619fl44 Gmiu*td1caE DedNerei diilet1 $4 C NOM S&T3 D0c d U 4 dr luthtll tigi000ll full pwr _4$z r FOND Nidiet ieiøw mile Rare krenacidlte ie 6t502 70P*c $180 17 OuHOi 91e $800 70niciid* a 4031 N Shtn ve T7347$ miri" ( ::\ uì" 1 \( )1 i : k Fr Kevin Hward Buick Pntiac GMC trr GROUP \)iiii tlo li i 6i il t /ll \ii i \\\

z E at t w t) Q j by JLL CMNLLO 5eachCbcag utt Editr idm}nflluntlmecm have t admit Lexu ha dne uch a great jb th it vehicle that thcyve actually becme a bit bring S weh made S kixuriu S cmfrtable S uninpiring S predictable Which i why liding behind the wheel f the 2010 RX 350 va uch a nice urprie Thi benchmark crver may lk familiar with the hape that launched the egment but dnt let that fl yu Thi vehicle i all new fr 201 O and it ha raied the bar again Fm typicallynt a fan f anything larger than a cupe fr my pernal ue but after driving the R( 350 fr a week it ha jined the Nian Maxima n my tppick lit Uually when hp int a new car there a learning curve Smetime it a day metime m in the car a whle week and till dnt quite get it But with the lîx 350 it wa like driving a car d driven a millin time befre N learning autspecs D!!R4fl f twh el dr ye l Wheel drive Fuil4cNM 18 citw24 highway (WO) cityii25 highway (FWD) : : : h5 Pkcf S37625 ; STESTD:$52965 *ìe im wwwlexucm m e O curve N real frutratin with cntrl Jut the familiar and cmfrtable cniun f dnvmg a vehicle that ve driven befre Thi i ne f the crver that ha a very catlike tide fr peple wh are ued t driv ng a cdaii the jump t the J( 350 int that diffcrctt Ride and handling i mth and even and nly the larget f the Chicag pthle will jtle the vehicle uncmfrtably nd while yu arent ging t tacc the RX 350 ut n a race track it i nice t knw that the crver crner ptetty well and accelerate even better Equipped with the 35liter 6 engine the RX 350 i perfectly pwered fr a 4343pund vehicle t deliver 275 hrepwer and 257 pundfeet f trque The ixpeed autmatic tranmiin i well geared and cmbined with the 6 engine yull ntice mth eamle pwer during acceleratin The tet vehicle wa the tiplevel allwheel drive mdel and had a bae price f $39025 lt then prceeded t tack n an eyeppping $14000 in ptin bringing the ateted price t a whpping $52965 While like the tart price f le than $40000 J thught 353000 wa a bit exceive The tet vehicle added pricey package like the cmfrt package ($2000) reareat entertainment with navigatin ($49110) andluxurypackagc ($4800) flen it added a bevy f leer ptin uch a the premium audi ytem ($(tlo) park ait ($500 tw prep package ($238 cat mat wheel lck $8l) gla breakage enr $205) remte engine tart ($375) and the can net 59) Way way t much tuff if yu ak me f vere ptinig thi car d really nly nt the navigatin ytem and the breakage enr ( d live in Chicag after all) But the hard thing i n the Lexu Web ite it appear that yu can nly get navigatin "with additinal ptin" fr 6658 which mean m lking at a minimum f $45733 fr the pricing Ugh The bae RX mdel i frntwheel drive and tart at $37625 4 t:th One f the rean d be willing pay fr the nay ytem thugh ic the nev nbard cmputer immediately fell m lve with thi ytem which i managed by a unique remte tuth cntrller Unlike the udi MMir the BMW Drive the Lexu nbard cmputer really i intuitive nd it et up that the cntrlkr i familiar lt feel ut lika mue and it ituated right where yud fnil a mue next t yur keybard The enter and back buttn arc a finger tuch away and mving the cntrller i eay and familiar Thrn the ytem itelf wrk the way yud expect it t and all the infrmatin yu need i fund withut paging thrugh multiple creen Brav Lexui Overall the interir f the RX 350 i well dne Fit and finih i ccellent and all the tuch pint vcre lid a yud expect frm Lexu The eat were cmfrtable and infinitely adjut_ able that gt a great driving pitin really liked that J culd ir up high and have great viibility ur all windw The ettenr f the new RX 350 int t different frm the previu generatin The verall hape i a little mre rehned and there arc me harper edge but the taillight will be the big clue t the new mdel When yure lking at luxury crver the new RX ha a lt ging fr it The technlgy i cl and intuitive The tide and handling i great The interir i cmfrtable nd with it eay maneucrnbility it make fr a pretty gdthy car The tiffet cmpetitin that the allnew RX will fce i ging t be in the frm f the 2009 udi Q5 which cme tandard with allwhcel drive 1 havent hac an extended tet in the Q5 but the brief time had behind the wheel wa btti prty and cmfrtable Plu it ha a bae price f $37200 which i a bit f a ing t the RX pricing 6 rnt w E SPEK "OUR LGUGE J_ t SPNSH POLSH RUSSN TGLOG J i SERBN MENN & ENGLSH yid MP1TW ZflMa RETTFR flel!!!êj 2k;t nj JJÍçj 1Ïy GNOS GOT T! ii 1 t BENSENLLE/ELMHURST ; iroò9 NOW ONLY : #9128 (630) 8603100 $LE$ M F9MtO9PM STDMOOPM SERCE M F73QPM6PM STOMt04PM aearaec: : : :: n: ìçj: e E 1Saik NOW ONLY iì6òöoom /flrj 7/100 t/øq 000 Mi* S Çrnpt*hntt 3rO : :c : prlit Y1mQ ;:": Ore;:c L :ì; r : : 1 i ; :11 : : j#9205 J a: t _: ; L g 0 P 1S* DSOU U* lus CUWS$N Ort tnnep1*n tcw 110 whle trr5ly ait vel i nly ai avv Flly quppd t)rqcs mvtl e 3999 *&* =Jhtt $3999 PSNT U* S Ledgt Unb4fvbty picnt at t = u 4999 00 rwt n rt9gi Jtty4t $4999 W PlU e cvv u Crn n d d* thi grl tefltctt 54999 t St 000k to S ca MCUP Wadi Ct P*5y Hun4 4999 _S$ i=:= NPlS SMLY S flu Hdtttnd n 0* Wilt 51? ttt S vw S*T 1 Ljdt Lthe ut 00f nich fljti mt 55999 2SS t S WttlUlU t 55999 S lu ndirpøwt_1 Huy th 00 wilt e0 ftt S999 _* v_ ClU Z tcç $0999 _a PSS 1* ai J k 1m f w wth cnngt HURFY 09O9 Ldd JflOOdß Ttp Hlc*btpfl $7999 1 u SWU UT w qu)ptd ply 01 mdprtd 5 gim 7a999 SS SCU NiC&y QUpOød t 57999 t01 a lt f mney cav S Wøit and t*tt $7999 W4 tflcd S2 TS WU CUWL* COnvtbJ Wethr ht Hnyt 5k_099 1 u = MSUTS i y h t flndi Hny We th tmt 5 01999 2514 M 3 wtg qu000dii Sptly d ttfl O dtli 581999 1 PSUD xpou tmpt15 t flndt Uaht un00f thld 0W d mr 58999 ZSSS w LOtOd With ft _ and muct mre 55999 2S awv 1(2 TON PCkUP O*tht Hnyt 8999 ZS OUOU welt qptd CcflMct p4cd RQht 9999 2505 cw MUU M*XX Fully qppd vtikt $9999 K 01050 1 twy 2SS SU Fully qptwdl Od twhc M Qnd Ple 5 9g999 25S5 kia OU ntnin kdd With &ty fat 59999 x a PUOT Ort lking SU Ntcty quppdi Plcd flghtt 5 2SSS TOYUf Y Nicw q Nicty pood DOSSM SiT Ht d rd nd tdd With ftnt ZSSS U T _da inctding tto ir d m1 m S 9g999 $9999 9t999 $9999 2504 iew1 SlU wg qtp nd p1cd riuni 1O999 21 csy$&s TCUN S COUflR ts Fiiiy q i pricd t nly 1O999 255* W P*$*T $ 4MulU Spe4l EliSini a DSS n00n00 lind mcil mr 11999 CN SiT Ldd nldig mw N Gl 11999 255 Ldd nly 3k rt mil Hrryt 11999 z PSUP SCP W ECt W hot iy yor nil 1 2999 ci Rrl Hnyl Ud ScinS 011 fti 3999 ZS 00051 tçw Thi 11W Onl Hyt 514999 KT WN M* Lddli Grt mn t t3yil HUR 14 30*2 1W 33itl Laddi Hunvt 01 n will 0011 fti 5 5999 7 in TS $C ni mut c and dogal ml the nl 1599 FNNCNG TROUBLES? OONT WT C4LL WYNE Lt w tthl ptctii gt yautt tnatwttlj yu detvc 7737O495O5

:: i z E u r i 2009 Hnda CiviC d ivò CR 4 Wheel Drive 3 9% t e a Li utmatic Mdal F1$UEW Stk*H22547 Per MnttrFv 24 Mnth Mde 0 RE4$39rH U1U Slil 1122550 ji Per Mnth Fr 36 Mnth 2tK332cK7CCORDS PRFinancingÀilable!0$1257O OnSelèctMdel! T$P56 T$18961 i 20032007CmC$ Ft 9770::; a a ccrd Sd a * 1 LkllLWJkiii!iL a k 4 : J4 2009 Hnda Odyey 2G»2XJSODYSSZYS Fnm 12870 i O utntíc Mdal 0 CP2$39EW Stk0H2233e U Per Mnth Fr 36 Mnth Th Mdel RL382SEW Stiil 1122559 ç Per Mnth Fr 36 Mnth 20042009P1L0Th Frein 17770 S S 20032007CR4 Frm 13870 UédCar T$32831 T$27930 T $24631 Pice plu tax tlle licene and dc fee ail rebate and ncentive applied Financing n elect year make and mdel Baed n apprved credi t qualified buyer ffßaed n cled end leae b qualified buyér with apprved credil 12OOO allwable mte peryeaç15c fr each additinal mie (Odyey 2O) ll leae vehicle require tax tle licene & $15165 dc fee due at leae igning 09 CMc : Reidual: $13058 O9 ccrd : Reidual: $13425 O9CR : Reidual: $14100 09 Odyey : Reidual: $14053 dditinal pon extra Leee repnible frexce wearlteai mantenance and nurance Subject t early termlnaun penalty alid three day lrm publ)cal1n Dealer will nt hnr errr n thi advertiement Nt available with any prevu fler Exceeding iùr Expectátin Fr Over 3 r r tjt W) 4 g ii 2OUL PCS))EN1 W T t) 4 4r e

GYEJY STURDY B6 dh!3rsn g Cntinued frm PGE 85 NOne tr the 800k" the 78th annual WaaMu Shw 8 pin Mayl219; 2 r;;;;;;ny C5r eai;ble : Wviw$cre/tapeOnSfögecm MercuryTh10r773325 7OO T!cktmatèe 31 29O2 500 pm May3andlOatNrthwelen UnF verily Cahn uditrum 600 tnern SL Evantn Theperfrrne feature ng andke(chelvlving the fairy tale f tyòk phncee the adventure f Curiu Gerge the triel l Hlden Caulfield th&trbula tien f Humpty Dumpty and the pet BL/CK ENSEMBLE THETER and tin RUNNNÓ at4wdiy at at : CLOSNG PRL26 "BfRaialng Muically f«t EDY %ii cafl 7737694451 Fr Rerijn / nfrmatin v f ee Cumming and Walt Whitnian Tjcket: $21$28: $17 fr enir citizen; $11 fr fulltime tudent and children Fr ticket call (847) 4917282 r viit wwwwaamunrthweternedu "The Overwhelmlrg" thrugh May17 at Next Theatre Cmpany lcated at the Nye Cultural rt Center 927 NOW PLYNG * * JOFFREY BLLET CHCGO ( DNCE) PERFORMNG PRL 29MY i Àzue 3955 fr wwwplneerjcajcm THURSDY PRL 30 2009 :" Hy S Evantn Ticket: S2&$38 with dicunt fr tudent Call (841) 4751875 r viit wwwnexttheatrerg Rugh Cring" preented by Piccl Theatre thrugh May 30 at the Evantn rt Dept 600 Main St Evantn Curtain at 8 pm Friday and Saturday; 3 pm Sunday Ticket: $25; THE OERWHELMNG "HHLY REÒMÑÔEDt nteiy 9rDpn 5iTwn& teï3pénwf Theatre Cmpany Tue Sun at 7:3O Sat & Sun at 3:00 RT healed debate ver mdern art clr titi rich cmic tudy flnalefrietthhip Directed by Rick Snyder February 5 June 7 2009 CaH 3123354650 r Wwwteppenwlfrg T dvertie Pleae Cal! Greg iidi @3123212490 D e D $20 enir; $15 tudent and children Call (847) 4240089 rviit wwwpiccltheatrecm Smene Whtli Watch Over Me preented by Shapehifter Theatre thrugh May 9 at the rih merican Heritage Center 4626 N Knx Chicag Perlrmance at 8 pm Friday and il a : iii S ElF 48i;t 9y1i4 Jpri1 244f*7 ø Ñij &6&l8 N$# iijj 4Ly jg 7m3277077 rdanl rtiti Prni N BLLET OF ST PETERSBURG Bri Eifmn rtitic Directr ONEGN ONLY 4 PERFORMNCES MY 1417 UD1R1UM ThETR1 f p n TN1tfl!jfl 800982RTS(278j TicJcematercm Saturday; 3 pm Sunday Ticker: $15; $12 fr HC member Call (773) 282 7035 r viit wwwiriharnericanrq Sunday n the Parkwith Gerge" preented thrugh May17 by Big Nie Theatre Cmpany a dviin f Winnetka Theatre at The Prairie Lake Theater 515 E [hacker St De Plaine f * PRL JO4MY Z UPCOMNa PERFORMNCE$ 1964The Trbut: Sat June 6 Regeniatlen Tur Fil Jun 26 ROSEMONT THETRE Call: 32559212 ; wwwiieketmaatercm wwwremntthatmcm EE R PONEER PRESS PUBLCTON Perlrmance at B pm Friday and Saturday; Z pm Sunday Ticket: $20; S18 fr enr citizen; $12 fr chif dren 12 and under iit wwwbig nlethealrerg r call (847) 604 0275 "Tartuffe" will be preented b the Perfrming rt at Oaktn pril30 May 10 at Oaktn Cmmunity Cllege StudiOne 1600 E Glf Rad 0e Paine Perfrmance at 8 pm Mayl2 and 8; 2 pin May 3 and 10; and 7:30 pm Ma 7 brief dicuin fllw each perfrmance Ticket: $10; SB fr tudent and enir; $6 per pern fr grup f 15 r mie $5 preview perfrmance will be taged at 8 pm pril 30 Call (8471 6351900 The Wedding Slnger preented by The Riing Star Thealrb C thrugh May10 at The Stahl Family Theatre 5900 W Belmnt Chicag Perlrmance at 7:30 pm Saturday and 2 pm SundayGeneral admiin $15 with dicunt fr enir children arid grup Call (773) 7362490 r viit wwwriinqtartcrg CLSSCL lltate rena 6920 N Mannheim Rad Remnt ticket are available at wwwticketmatercm r (3)2) 559 1212; the ticket price lited belw d nt include ervice fee The infrma (in line i(847) 6354601 May 21 7:30 pm: ilinit and cnductr ndré Rieu and hi Jhann Strau Orchetra Ticket: $50$159 The Chicag Philharmnic Orchetra perfrm at 7 pm Sunday al Pick Stalger Cncert Hall n the Nrthwet em Univerity campu5 50 rt Circle ci (u OW fest"(eat 219363255 Fpigrup7l 298363258 vwtheátretthecenterm Theatre "a ; 0 P"uciwi Drive Evantn (841) 8666888 wwwchicagphilharrnnicrg Ticket: 520$70 Student ticket are $10 available in the lbby befre the perfrm ance May31: "Mzart Malerwrk" featuring Mzart Quartet in D fr Flute ilin ila and Cell with flute lit Jean Berkentck Mzart Quintet n EFat (r Hrn ilin tw ila and Cell will fllw willi lit Jnathan Ren French hrn Cncert fr ilin Pian and String Quartet by Ernet Chaun will cnclude the prgram Evantn Symphny Orchetra perfrm at 2:30 pm Sunday at Pick Staiqer Cncert Hall 50 rt Circle Orive Evantn (847) 8648804 wwwevantnymphnyrg Ticket in advance are $25; S20 fr enir citizen; SS fr tudent Ticket at the dr are $28: $23 fr enir; $5 fr tudent May 3: "The Painate Pian" with guet artit Camern Smith The prgram include the Brahm Symphny N 4 in E Minr and the Tchaikvky Pian Cncert N f in B flat Minr Lutkln Hall at Nrthwetern Univeri ty 700 Univerity Place Evantn 1847f 4674000 May3 3 pm Newberry Cnrt "rcadia Reviited: Garden f Earthly Delight" $24/S20/S1 May 3 1:30 pm Barque Muic Enemble " Celebratin l Gerg Philipp Telemann" Stephen ltp will cnduct the vcalit and intrumentalit f the Barque Muic Enemble in a per larmance f l cantata quartet fantaie and ther pieci by Telemann S71S51S4 May 4 73O Pm: Faciilty 1iianit Elizabeth Bucclinri eut Sylvia Wang will preent William Bl 9TH 15 STURDY MY CHOCOLME DY f1t41lneep700t(cf e lin? / )LJ : ie?w(5 aeccuc t iuiiflo e&cn ujwncqit 1040 KJpRQQd MtrlÑ :" :: g : Crn "bendmuik" ntnin Dvrak "legend" and Lenard Berntein "Symphnic Dance" frm "Wet Site Stry" $9/$7/$5 May 5 7 pm: Carl ane cal Mater Cla $7/55/54 May 7 7:30 pm: The Charivari Quintet and a grup f Bienen Schl f Muic wdwind tudent will appear in cncert The prgram include Maurice Ravel "Le Tmbeau de Cuperin" fr wdwind quintet and harp Carl Niefen Wdwind Quintet and Emil e Bernard Divertiement fr duble wdwind quintet $9157/55 "Mnday Muic at Millar" a mnthly muic perfrmance erie will be held frm 12:1512:45 pm May 4and June 1 al Nrthwetern Univerity lices Millar Chapel 1810 Sheridan Rad Evantn Free ttendee may bring a ack lunch t eat inide the chapel wweunrthweternedu/chaplain/pur pehtml Mtly Muic Chicag preent chicag Enemble at 4 pm May T at a private reidence in Evantn Elizandr CarciaMxntya clrrinet Mathia Tacke vilin and Gerald Rizzer pian wifi preent wrk by Paul Hindemith Bólà Rartók lban Berg and gr Stravinky $25: SS tr tudent wwwmtlymuicclìlcxgcrn Muic f the Barque perfrm at Firt United Methdit Church f Evantn 1630 lininan ve unle nled therwie (312) 5511414 wwwburquerg Single ticket are S30$75 $25$30 tudent/enir May 17 7:30 pm: "Muical Firewrk" featuring Muic f the Barque Orchetra Nichla Kraenier cnductr The prgrem include Handel: Cncer ( a due cri N Z in F Majr; Haydn; Symphny Ni) 80 in D Minr; Haydn: Synuphny N 92 in G Majr (Oxfrd); and Hañdel: Muic fr the Ryal Fire wrk Muic ntitute f Chicag Nichl Cncert Half 1490 Chicag ve Eventdn (847) 905lSOO wwwmuicintrq May 3 3 pm: MC perfor u a wwwpióneerlcalcm (JheB5f:fl B? «Mance Serie: "Seven Wnder" il nit Rachel Bartn Pine and narratr Carl Grapentine perfrm Stravinky eptet "Lhitire du Sldat l mime T Daniel and Laurie Willet jin the MC Chamber Player fr Milhaud1 "Le Beuf ur fe Tit" $7520 Nrth Shre Chral Sciety cncert are at 3 pm Sunday at the Parih Church f Saint Luke 939 Hinman ve Evantn Ticket in advance are $22; $20 enir; $12 tudent Ticket at the dr are $25; $22 enir; $15 tudent (847) 2722351 wwwnrthhrechralrg May 31: "Ethereal Light" with guet cnductr David Edeifelt The prgram include wrk by Gabriel Faure Sergie Rachmaninv and Mrtn lauriden Nrthwet Symphny 0rchetra Paul ermel muic directr preent chcert at 3:30 pm Sunday in the Theatre fr the Perfrming rt at Maine Wet High Schl 1755 S Wlf Rad De Plaine Precncert cmmentarie by Carlyn Paulin a taff member f radi tatin WRT begin ne hur pri r t each cncert Ticket: $20; S15 fr enir; $10 fr tudent Children under age 14 are admitted free when ac cmpanied by a paying adult wwwnrthwetymphnyrg May 31: Family Pp Cncert with llan Steele cel Offenbach: Ballet Pariien; Llyd Webber: "Memry" frm "Cat"; William: "ET" highlight; William: Piece frm "Schindler Lit"; Dvrak: Cell Cncert Organ Plu: Muic fr Organ with ltmment 3 pm May17 at Lyla Uni verity Madnna della Strada Chapel 6525 N Sheridan Rad Chicag Organit are Je Burgi Jay Petern Steve Betancurt Brian DuSel! and Tdd Greick with Dan Legacy n vi lin PickStalger Cncert Hall at Nrth wetern Univerity 50 rt Circle Orive Evantn (847) 4674000 wwwpicktaigerrg May 1 7:30 pm: Pianit Jeffrey Siegel will preent a "i : i: Keybard Cnveratin perfrmance tilled "Muical Picture: The prgram include Rachmaninff "Etude Tableaux7 Debuy "Prelude" and Murgky "Picture at an Exhibitin $23/521/516 May 2 7:30 pm: The Nrthwetern Univerity Chamber Orchetra with Ellen Huntingtn a flute lit The prgram will include Bernhard Rmberg Flute Cncert and ntn Bruckner Symphny N4 ("Rmantic") 57/55/54 May 8 7:30 pr: Symphnic Band "ce Dream" $7151$4_ May9tO 7:30 pm: The Nrthwetern Univerity Symphnic Chirarid Symphny Orchetra will preent Carl Ortf cantata "Carmina Burana Rbert Harri and Emanuele ndrizzi will cnduct and Samantha Barne will be the pran lit Bth cncert will al include Ottrin Repighi "Pini di Rma" pen h 12:00pm n r Mther Day a rnura% t Gr ii"" ("Pine f Rme") and Carlile Flyd "int lt a Pretty Night?" frm hi merican flk pera "Suannah" $12/59/56 The Red Re Chifdren Chir f Lake Cunty will preent it pring cncett at 730 pm May3 at PickStaiger Cncert Hall 50 rt Circle Drive Evantn Ticket: 515; $12 fr tudent (841) 5488432 Regentein Recital Hall at Nrthwetem Univerity 60 ct Circle Drive Evantn (84?) 4674000 May6 7:30 pm: Cellit Luca Fel a member f the rditti Quartet and a funding member f the newmuic grup Enemble Recherche will perfrm The prgram include wrk by Rihm Luigi Daiiapiccia and Han Thmalla g PGE 88 FRESH HNDMDE PST GRET STEKS Cup FRESh SEFOOD DLY Crne ce1brte Mther Day r cater her favrite meal Call t 847) 2975555 fmr reervxut in! Regular Menu nanqucr Rm and Oiijd Ciicrin Nw Opn vr unch & Dinner 11147)1975555 8808 N Mlaukcv e Nic L 60714 On ihç utncr f viulc \e nc Dmptcr) OEN 7 )S Mu Tur 51M DlM Fr1 & Sii 5CM lpl Sur 4P5l1Ut Y RiJ)itliuc()11 Centre Eat Preent wfle*e inlp*5t tnmn4$ L r*turn Sind5 H*ckett 000 f cmeöy legsll EuOY KCet MY 9 T 3 & 8 PM Ticket: 8476736300 r wwwcentréeatrg Sf%fi 10% lttu qfuj> ut 15 Of ST5DTE ca 11114477849 tri n la&jih NOETS SfOR clvtlr rn t rnrnuwe Ri r i! lk lel ci:y

B8 e irîu 1 ciidtrøiid \prí 24M 4alr3 E:readay J wwwpineerlcalcm rz3 :rt tce iti xeçc a ards2 Cntinued frm PGE 07 Exi ri CC 3 ct S t:; cetrcati; tr C lt r? a: S7JSî$4 :çr iaaçfc Tt S7S25 Jury Seçcvia c1akt Gdt& Sere h(d lt jra Erra n n c; Mrth&en Urit Ertca car arai HC( x c&lrp(1 CaL (847) W4CCOcr irt 369E) S45G E? t 730 pn BfrBfuetGZa SEaataC Bcqu Lte rd çuitar artrt F{crrr (247j 24 cn Strith wurfcm in Lutin Hat h1at(t5tlacaccr Cca he 700 Uní&ityPaceThe prcqram arj S&indaj a L4et ckde r bí T7th ecturj Frrdi Me Mxiay : c m ktecrit cd ccrçr ie Cub Pr Jazz Jam Tueday S 30 r_ a4 a nuic bywe& BadL Bdl 8ua Jam trte l 1FB Gcect Santa Cruz ari Sanz Bri Wedneday 50 p rp 1rt) S1íWS8 Stcr Stecn (DJt Wedneday 1030 Skthaßey Syur chetra pin: Jahr fr Ura Daice Ça p&n at 3 pin Sday a te (Di) piî 30 7 p1t LrWe Grant B:ue cdfl Scce Center fc the Pertcimr Bend May 1 5 33 p r} fiitneri?icr 5 ct 9S3 Skkie 8 Skckie flcket Band Jazz May 1 9 pm RC Reaae as2z$3á; $9 fc cen Free pce Shw May2 3 pin: ttn Preent ccncert fedure beç at t30 pm Fc (rck) May 2 630 p w Lui Zaqra cafle47)6floocyiit Band (blue/rck) May 2 U 30 pm wwc(q May17: Featuting the TRC Eent Preent (er!d muic) Ryan Oçea Center (nenb1e Mzart May 3 7 p ni: Claudia Njqaard )flk) Overttte t t&i(t;n Frm the May 7 7 PiP: Li) Fet Preent flk) Seraqli Syrnphcri U 38 ÇPraque May? to p m: lrthuetern Band and pera cefle emtaçed?iiçht (rck) The Celtic Knt Public Hue 626 POP/FOLK/JZZ Church St Evartn (847) 864!619 wwce)tickntpub cm N cver un 5tate rena 6920 ft Mannheim )e nted therwie Mnday 8 p ni Rad Recnnt rcet5 ce aaable midniqht Bluegra and rt muic at wr&tkketmateccm r (312) 559 with the Mudf)app Tueday 710 the ticket price ited belw d p ra: rih muic ein Thurday 8 rit include ervke lee The infrma l pm: rih muic ein Featuring tici flne i (841) 63566O1 May 45 Jee langen Deirn Shepherd and tu 7:30 pinthe Dead $95 S50 May 9 dent frm The Muica) Offering May 6:30 put ran Out Bcq with Metr Sta 9 io pm: Luke Saver May 23 10pm tien Cbra Starhip and ll Time Lw Biueqra dvcate Centre Eat in the flrth Shre Center lof thy Pefrmin rt 950F Skkie E ad Skie t847) 6736300 wr«cen vtr May9300d8)fmihe :3a rack i Back Tribute t Frank Samnri Jej and Dean S5 Ethical Humanit Sciety Secnd Sat :103/ Ccffeue 7574 N Linc)n ve at Hard) Skkie (847) 6773334 a a ethicathuman rg Hay F!kirqer Cail and David Hardety at 8 p w fllwing pen mic (730 pm nun all genre al) acutic) S5 Germanmerican Children Chru and te Germanmerican Singer f Chcac il preent a F1ther Day cicert and dance at 230 p m May17 at the )rihmerrcan Heritage Center 4626 fi Knu Chicag S9 in advance; ; at the dr Free admiin fr chi) dren under 14 aww dakinderchrrq rih merican Heritage Center 4626 N Kn ve Chicag (713) 2827035 wuw irihamhc crn May 9 8 pm: The Kilkenny Cat)e )nn Reunin Cncert featuring the 000)ey Brther and Brgue S20 May 28 730 pm; The Dublin City Rambler $20 Eptertainment at 9 p m Friday and Saturday in the Fifth Prvince Lunge n cver May 1: Cei)i Dancing May 2 Mulligan Stew May 8; Dyed in the Wl Mretti Ritrante &Pizzeria 1799 S Bue Rad Munt Prpect (847) 5932200 wvawrnrettichicaqcm May 1; Dei Grve (claic rck and R&B) May2 &Factr (claic t current pp rck cver) May 8: Tumbleweed Tri (Uaic rch) May9 Hward & the White By (R&B blue and rch) The Oak Street Band vii)) perfrm muic f the )960c al ari event pnred by the Swe)ih Cultural Sciety f Chicag at 3 pm May3 in ictry Hall f living Park Lutheran Church 3938 H Bette Plaine ves Chicag freewill ffering Oaktn Cmmunity Clleçe Pert nu ing rt Center 1600 E Glf Rad Be Ptaine (841) 6351900 May 6 8pm: Oehtri Jazz Band preent a electin f winqing jan tandard under the directin f Carey Pfacek Ticket: $5; $3 fr tudent and enir Regentein Recital Hall at Nrthwetem Univerity 60 rt Circle Drive Evantn (847) 4674000 May 5 730 pm: Jazz Sinati Enembte Cncert Free Remat Theatre 5400 N River Rad Remnt Ticket are available at wwwticketrnatercm r f332) 559 1212; the ticket price lited belw d nt include ervice fee Fr mre infrmatin abut the theater cal) 1841) 6715100 May t92üand Julyl: n Evening with D Div $55 $85 $125 and S150 THURSDY PRL 30?g Skkie Theatre Muic Fundatin reent cncert in the Skkie Theatre 7924 Lincln ve Skkie Call (847) 6T7T761 r viit wwwbkietheatrecm Cncert ticket $20 in advance; $25 at the dr unle nted therwiepril 30 8 prn The ndrea Kapali Tri $15 in advance; $20 at the dr May 6 130 pm: "Muic f the Wrtd with Guitar f Spain $10 in advance; $15 at the dr Senir and Mile Twnhip reident $10 advance r at the dr May8 8 pm: "Geihwin Greatet Hit" with Elaine Dame 8 pm Be Gd T Yur Mther" Kl McCammnd with Bb Mreen 2 pm ßecaue f Yu" a trib PONEER PRESS PUB1C11ON ute t TOnY Bennett tarring Rbert Whartn Maye i pm: "Steppin Out featuring "Jerey By tar Michael ngerll in cncert S35 n advance; $44 at the dr May20 1:30 pm: "Cme t the Cabaret" tarring Heather Mran $10 n advance; $15 at the dr Senir and Hile Twnhip reident $30 advance r at the dr May 21 8 pm Megitza Quartet $15 n advance; $20 at the dr May 24 7:30 pm " Sunday Kind f Lve: May 27 1:30 pm: "Flk Sng f ltini" with Bucky Halker and Dn Sternbierg Free SPCL 1245 Chicag ve Evantn (847) 4928860 wwwevantnpacecm May 1 7 pm: Catie Curti (flk) $20 n advance May 10 pm: Charlie Hunter Du featuring Simn Ltt (jazz) $18 n advance May 8 pm: Rbbie Fulk and Friend; cutic Full Band Shw (cuntry/rck) $18 inadvance May 37 pm: Paul Geremia with Jim Craig (flk) $15 in advance May7 8 pm: Eric Bibb with Diamnd Jim Greene (bfue/ffk) $25 in advance; $30 at the dr May 8 B pm: Brightn M and Hallween laka (indie rck) $10 in advance RT GLLERES Cngregatin Orlrab 3800 W Dempter St Skkie May 3 15 pm: 1 raeli Judaica Butique and rt Sale featuring the wrk f artit frm Raanana rael Emily Oak Nature Center 4650 Brummef St Skkie (847) 6741500 Gallery hur are 8 am5 pm Mn day{riday; 8 am4 pm Saturday: and 10 am:4 pm Sunday Thrugh May 2 Skkie rt Guild 2009 member pring exhibit "Nature Palette" Oaktn Cmmunity Cllege Kehnline Mueum f rt 1600 E Glf Rad De Plaine (847) 632633 wwwaktnedulrriueum Gallery hur: 10 am6 pm MndayFriday; 11 am4 pm Saturday May 7June 18: "nk Painting by aigu Jieng: Figure" teature the wrk f Oigu Jiang prfer f art at the Schl f the rt lntilut f Chicag practitiner f Chinee uim (waterink) painting Oigu Jiang early wrk emulated the f China ld mater lfering traditinal theme a bamb and landcape Upn hinriival in merica Oiga Jiang ught ut neviway t explre the human figure thrugh an extenive practice withink bruh and rice paper Opening receptin frm 58 pm May? Skkie rtouild artit hwing thrugh pril 30 ndude Hpe Sa)manff exhibiting her il painting at Bank f Linclnwd 4433 W luhy ve Linclnwd and Claire L Hirch exhibiting her il painting at the Devnhire Cultural Center 4400 Greenwd St Skkie UDTONS & OPPORTUNTES STGE Saint Patrick and The Riing Star theatre cmpanie annunce auditin fr "Jeph and the mazing Techniclr Dreamcat" t be held at 6850 W ddin Chicag Open call fr children age O14 frm 9 amnn May 23 Teen age 15 and up and adult by appintment n May 2128 Prepare 32 bar f an upbeat ng and bring heet muic in prper key ccmpanit prvided Teen and adult huld be prepared t dance ll rle pen; n pay Perfrmance are weekend July 24ug 2 al the Stahl Famiy Theatre 5900 W Belmnt; Chicag Cntact Geffrey rndt (773) 282 wwwplneerlcalcm 8844 eut 276 r email garndt@tpatrickrg mges The Muic ntitute f Chicag Children Chir will hld auditin fr the 200910 academic year frm 5? pm May 21 at the Evantn Eat Campu 1490 Chicag vefl Evantn parent/guardian f ntereted inger age 7 t 18 huld call (847) 4488324 t chedule an auditin RTßTS Cuter lat Stand acceptilig art and craft exhibitr applicatin fr it 2009 fetival f the art t be held June 2021 in the Evantn Main Street Statin Shpping Ditrict pplicatin deadline i May 1 Call (841) 3282204 r viit wwwcuterfaircm t Cailfr artlh fr the ShaMe rt Gtlld 48th annual rt Fair t be held Julyfl12 n the Skkle illage Gren 5211 W Oaktn Shkie Prize and award Email kkieart@aolcm r call (847) 6778163 MScELLNEu The Shining Ught a prfeinal Jewih yuth entertainment grup will hld auditin fr new member n May613 and 18 in Deerfield The grup i eeking talented Jewih teen wh can ing and dance uditin are pen t the currently in grade 5Fl The Shining Light perfrmance ean run frm fall thrugh pring at variu lcatin event and fetival thrughut the Chicag area ncluding the Chicag Jewih rt Fetival and the City f Chicag Hlcaut k 44 t BENEFTS dvrin 09 Remembrance Day Obervance T regiter and receive an auditin packet e mall ShLightla@alcOm r call (847) 9400455 uditn date are ubject t change Spring Benefit EXNbltOS and rt uctian thrugh May16 at the Evantn rt Center 2603 Sheridan Rad The public can view and bid n painting drawing phtgraph ceramic culpture print and ther artwrk dnated by mre than 150 Chlcagg area artit The ilent auctin and enhibitin will be free and pen t the puhlic until 5 pm May 16 The fundraier will culminate at T pm May16 L a g PGE 011 GE YOUR MOM MLLON DOLLR TRET! i npts Çhiçag Suthland Pxemlere Entertilnnent enue U : i : b t : : v rwlj ro(oi:1:: Tc4b 7082352222 centerticketnet b CM kxwd C : m Sa* i b Citie Blunt Murder Mytery and Dinner Reervatin Limited Call MnFri (773) 2676400 www myteryltdcin b 55 J : l ; S 1 ; : S u k S a b t a L a 1 i 1 :_ ReervatiOnS required Mentin iler when rdering ticket Subject f availabllhay Cal 3O5846342 fr dicunt Rr hwnly ticket finirf bu cnbind with any ther ffer r l prviuh purchaed ticket Oiw cupn pet ticket RiictiOilS iaaynpply alid hm 5133/09 rder GdfrUP ( turilalprrliaed 1

r 80l Served Lttfr FÁL [%*J ii 5050 N CUMBERLNÒJ NÒRRDGE v (708)4562005 We Delivér! DPPERS STiMULUS PCKGEME LS Great meal at a prke that wònt put yu ver budget! e i i :00 M t 9:00 PM Mnday thru Friddy Chòe frm: Spinach Pie w/cc & Fruit Pulled Prk Salad Chicken Finger Salad Beef Criper:w/FF Rtini w/sauage Liver and Onin Çhicken Tender Breaded Prk Tendedin Sweet & Sur Çhicken Fried Filet f Perch Chpped Steak w/onin Grecian Style Chiçken Spaghetti w/meat Ball Sup r $alad i 50 with ñièàl nclude Glà Wine wwwplneerlcalcm rt ç i 44 $ Mictiae Dua nd Matthew McCnuqhy in By BRUCE fngrm Film Critft Ght f Grfrend Pa Fr turn th J)Se( u the ic1c: th:t caual ex i an m)ty il\()ous OlTh) tinally hinde( past ine thete an ati lt f it bandied abmil in "(ht f Girjfpiezuj lt" ke il a\ay and (helc3d be nthing fr t13()5t t talk abut That all right thugh "Gir!friexl" dent really have u pint t make aide linì a latalintite brmide abut true lve being wrth the rik 1 a brken heart and WS lutily enteitaiiing while it ge tbtit nt making it Baical1) "Girlfriend i the tuiy f the rnuiiltje reeducatin f a vililcla òn1afljzej Matthew MeCnaughey i appzpriately bnxiu a Cnnj Mead a wman lving/hating fahin phtgrapht wh get great reult by StijJphlg grgeu PO) tar dwii t their underweai inulting them and clicking the hutterjut at the mment an Olympic archei ht apple Tthejj head Generally the pht turn ut vell but mre impartmnt fbi Cnnt hi Lit) ject typically JOn)1) directly int hi bed When One ftimm wnder why he behaving that way Cnnr ffei n liftie Playby dvir pyçl)an alytical inight: " Utilly it Ght f Girlfriend Pat ha SO11Lt hing t (O with y(ju thlici" (1r t hik nthiiig 1 breaking UJ) with three \OflÌCfl iir)til( aneuly On a (Ofllie15ce (al! (líe lin P1tJSSed 1)1 time ere ging t have t d thi in bulk") and he ha iiugh (ast()ff Cnquet t C) li l a 1)0 )1O()fl t lie ize f tl? tate f r¼1()fltia U hi wn ug hiclievei i lagei rll1it a P()itit that vill eeiitu:ij1 k)o ílraniatjeal jiltit rated t hi liiiøi n hit t lie guy i a COOS5l Ca(l it flt e))$jj()j hi iull thugh je ira lnie chled in ega and Hangkk l hi SCXC))zed iich uncle \iyne (Michael Dugla WOflde!tUlly leazy) whe Ottjttlde tad the lttdit COie traight lii 1lugh llelner by ay aithe Rat Pack nd he liad hi little heait l)()kci in middle chl by hi ne ttue Ove S it ll) tprie year latei; hefl lie reluctantly Se\itig a bet timn at hi little btthei wedding that he (le hi bet t bieak up the niarriage i that he flinke a little Sl)eCCli at thu rehearal dinner wheie he declaie that "lve j T1agicil C()uf()t üi(;(l tui the weak flach Lncducatid" t a Surplie t Cannai; thugh lieii hi lngdeceae(l uuel& hv up t d the (Ylailey Ght thing fhe COfltjfltteS t di kive Ujwje \ayne ay hell CiSl LiJ) kt and alune like he (lid S lie THURSDY PRL 30 2009 Rmantic reeducatiñ in Ght f Girlfriend Pat arranged fi the ght! girlfriend pat preent and future t viit Cni and hw him the errr f hi way But Wayne careful nt t blw hi lngcultivated cl "ThÇ int fr yur wn gd" he ay "t fr my entertain ment" nd it i urpriingly enjyable thank t a nice lightcmic tuch by diiec tr Mark Water ("Mean Girl") a narky cript auth zingy perfrmance frm everal f the wmen in the cat wh eem equally appalled by Cnnr uavely piggih behavir and their wn attractin t him There nthing unexpécted abut thé utcme fcure Jenny (Jennifer Garnet) the girl wh brke Cnnr heart whm he ha ecretly lved all hi life ha grwui ûp t becmé tie bridemaid at the wedding and the nly wman n the premie in cntrl f hr libid There little dubt where that ging But at leat "Girlfriend" ha enugh mart t wink at itelfat bit while it ging thrqiigh the rmcm mtin "What are we ging t d nw?" Cnnr ak the ght wh trying t prve that he de actaally have feeling fr Jenn "Nw were ging t watch a rmantic nintige lyu and Jenny t Cyndi Laupei" rlljme fteu lime " he ay nd they d Cpumjijt: pineerltalcin PONEER PRESS PUBLCTON J Cntinu?d frm PGE 69 with a gala party featuring wine and refrehment and a live auctin f ap prximately 15 wrk Prceed frm the ale! artwrk wilt benefit the EC thl exhibitn and utreach prgram Ticket are SlOO per pern br the cling night event fr reer vatin cäll (847) 4755300 Dancng the Dream : Kazuaria" 7 pm pril 30 at the Nrth Shre Center lar the Perfrming rt 9501 Skkle Blvd SkkieThe Hadaah lundráier will leature th raeli dance cmpany Ranana Raz Ticket: $36 iit wwwchicaghadaahrg r call (B41)6756190 May Muic Marathn 8 pm Mayl thrugh 7 pm May 2 in Nrthwetern Univerity Regentein Recital Hall 60 rt Circle Drie Evantôn t 1:30 pin May 2 the marathn will cntinue at PickStaiger Cncért Hall 50 rt Cirde Drive with a ticketed cncert by the Nrthwetern Univerity Chamber Orchetra Perlrnìance by Nrth wetern tudent faculty and alumni a well a guet artit trua the Chica g area will feature muic ranging trni Rachmaninff t Radihead rtit wh wih t participate in the benelit mut raie $100 t "purchae" a 15minute time lt in the perfrmance chedule The marathn i pen t the public: admiin i $5 fr the pening night and then by dnatin beginning at midnight; Prceed bene (it The Peple Muic Schl a tuitin \ a free cmmunity muic chl lcated in Chicag Uptwn neighbrhd Fr a chedule f perfrmer and updated hriírmatin viit wwwnìuic marathncncertrg Red Blue n Blue Mnday" a cn; cerf featuringl Jewer & lh Native merican Blue llstar will be píeentad frm 6:301 pm May 4 at SPCL 1245 Chicag ve Eanti Prceed will benefit Evantn Mitchell Mueum f the merican ndian Ticket are $75 per pern and dude adipiin pizza alad and a beverage Cah bar Call (847) 4751030 n Evenng with Jhn Begen Swng Quintet 7 pm May15 at Lake Street Church 607 Lake St Evantn The grup fjazz muician will play wing tandard aciated with Benny Gdman and rtie Shaw a well a tune frm The Great merican Sng bk $15 fr firt ticket ubequent ticket are $12 each N admiin fee fr children under 12 Prceed benefit the Lake Street Church muic prgram Call (847) 8642181 BOOKS &POETRY rih merican Heritage Center 4626 N Knx ve Chicag (1731 2827035 wwwirihamhccm Great rih mari can Bk and uthr bk dicu ien grup meet at 2 pm the ecnd Sunday f the pinth unle nted therwie The dicuin i led by irgifla Gibbn a teacher at Oaktn Cmmunity Cllege May 3: The Snapperby Rddy Dyle Little City Fundatin Ued Bk Sale June 514 at Wetfield Old Orchard Shpping Center 4999 Old Orchard a wwwpineerlcalcm Center Skkie dmiin t the event i free except n pening night Friday June 5 when a $10 dnatin i charged Hur fr the event are 510 pm June 5: 10 ami pm June 612 13: 10 ams pm June 7 and 14; lo am 8 pm June 811 Prceed benefit the Palatinebaed Little City Fundatin which prvide prgram fr peple with diabilitie Senir Citizen Day i June lo Children Day i June il and Bargain Weekend i June 13l4Fr de tail and chedule update viit wwwlittlecitybksalecm Tmprice 374 Old Orchard Center StRie (847) 6759400 May3 2 pm: HGT interir deign expert Libby Langdn will ign fier new bk Libby Langdn Smalipace Slutin CHLDS PLY Big Nie Theatre Cmpany preent an Epecially fr Kid prductin f "Cinderella" May 217 at Prairie Lake Theatre 515 E thacker Rad De Plaine Suitable fr children age 3lO Shw time are l am and 2 pm Saturday and 11 am Sunday ll ticket are $10 and may be purchaed by calling (847) 6040215 r viiting wwwbignierg Cinderella" will be preented by Chicag Kid Cmpany at 10:30 am and nn May 78 and 22: 10:30 am May 12 14 1921 2629 June 2426 Julyl2 and 7D; and pm May 16 and July11 at the Stahl Family Theatre 5900 W Belmnt ve Chicag Ticket: $10 Call (773) 2059600 r viit e e g PGE f13 le e 1 C dveriun (811 STRRNG FNTS FÓR TWOWEEKS ONLY! SEPTEMBER 213 OPRHW1NFREY PRESEN tkketnäter FÒúr chéi fr F t i Seeñ TheCörPù"k H SEE T NO f yu have een it : SEE rr ON Ticket al available at Tlcketmatercm all Ticketmater retail lcatin ant the Me Crwn Theater bx ttic Bx ffice hur: MnSat i 2PM6PM W abh ç ;;Y WN t e * S SLE NQWJ! _74513 _4 L E i /

"Bet Ellitt/u BS aiversilt wwwpleneerlcalcm THURSDY PRL 32 2009 STGE Play explre reactin t b wrd t l/nets PRESS PUbLiCTON wwwplnearlcalcm diverin /BS BN? Mr lojurie Q phn ireeui S ten Si O Carrpbeil 5t_ rbtnr?jopnrthurdey t per 111/0507 Ell n Myl dtopre n Hy H pnv Ouiurduy 00115 far 20011050 hn 22H$4f 54/ 5772121er B/ Mlrpflu Pertrrrrin Sucer 000nfrplu/narr 9 MOTHERS DY CHMPGNE BRUNCH /Th 9:3Oam2:OOpm teobnd \ Evantn Bet Champagne Brunch rhe her $1995/pern jkid under 10 yr $895 Recmmndcd 047064UEÇ (R52) 502 SilermG rove Evyiii il US 60201 wwwrrrriam000eturenl crn Parking available acr nlreel a/fleet Wetern pgpt EHL SHOWS TODY T 2:00 & a: Beatle Tribute n Earth" Rllin Swzc STURDY JUNE TH FRDY JUNE 2TH lilow ll 0lrttfl0 ROS EM ON T C/r 8007453000 /nit: Wwwticketmatercm ra n Www055emntpheahecm r v//t the he ffice By MRN PETLCK Cntrit/r 5001r! Lur Drih n/laer rli Orn ntaly penin Muti et Mr krau Perfr OS rt ferire in Orlinqin cethie Three cuple cn/nm pl/n childbirth frm very ditfrrrnt pniatrlin in Baby pening May 54 rit Mrtrplin letcming ct C tm in rlingtn Hnightc crte Lcirn Banitb directin tith humr md tendernene ihr muial lry frncrd Ubic linaic) Richard Mitby Jr llfric) and Sykille Pearn hak) chart tir high rind lac ni hing child rhrr yrr think i/ t n nn ctn cr mum pri fl c i/il riill rner hapurc degrain inimical theater Cmic thirter rit \i/rrba Unrveri/p in La ce Win tridyirrg in /atie Urn nf Lake Znmich Lcndnn bec janiar ync play Liir rba dinanc Sinn graduating /02004 that hr and hc baytriend ire rn pcifrmad in three Dany bth till in cllege ilier ham it Metrpli irre gnirrg tbe Sacan/ a mlt in hildccn Sin dacdbad Lnian hter prdactinn a/bc "ry clbiivirmtic She Marritt Thea/in in Linthink cery namicaily Uhr calnldre rind Sacy Lane libr/ think bain ncry Waten Tarci; and mn Sthing in Stia aci5000r h daati000a/ Ligh/ Opera ecachiirg hnrc i tiran hc Wrk "Clriagnn bcn and ham h aff/n tlia gnd ta me" Siri aid Like Bici Sacid Ruin/S rif Thit phitnaphy in Mctan Uran i clna bill erben/ed irr the painerfat time tar He play Dean ct nn dnr th atracar Wnhbcc and Enemble ter nicgn "Tha SOary Gnn Mrbr J ri mall Un" "21h pcbably thrnag r tintndying the raie f fnycarcrn far /hn lan hal/f/h lder mang Sre mt nci/d/ npla mr rlincce they perfarm" Blei declarad cr braming prrnta Plylg the mie ha iibnin cyed B/ri tanani/er rebat it mald bel/he labe What t expect pregnant " cantan/ly ac Dean Wnbbrr npprar i pregnant mme mhen m the ng "Pathnrhnd nat nnd kind f hace thin Binen" "0/n hlp rplein t nn redr 0h rygeti the yimg gy mhnh ging thereb r Wh/in he tabac a habg hw gr thinh/ngl it $ hay thi i t bcca hid" Ellitt avtaamd uppecintin fr aid "Tu think yna have ripr mh pregeril nr pien/y a7 mney Kin il all recently bd bah21" he gdbye Cauce gaing lhr id "t 0010 pae f mp rtremeiy lraptry ke line life that m int ye/at i lt anriccarmnlabln gide/art tluìnbing abut that dinc nd a mylaina d wndecingmhe it a/dean Welher i that like ba bnrnlly fa hen nary giddy himns" pr/nn" louat na/cd thrit mui The phae cf Bin lige il/rean MicOv Yrh wh that tre a/la i act/vl5 wnchingmith n inicm and 0500elully parain Ecmer in Cldag in nlrcnurm "ren luhn hn theatac Blei carried cm/c mcmheru a i i am playig tira iraa baby cle nd ddd thnm 00 h ather pi000 f rin arhentru Thech une pniiiit /nth hw wher 0900 peuple i rn Lizie and Day the yung 000ple ing rebrn it y heavenly chair j/n them and ne unce in Yneh i hd21 the hein rly chir parttipat in Ove r nia ther ng" Ellitt udmitted tht hr had hpd t ply the raie uf lan "Whet bnbd m neg that l ing dulled linier / Lnvm th a very tuching Ong" B thagh h didnt land hr pithe wnted tire aetur i ntr/l happy t br prt nf thin pmdctian hin eighth r ninth etsiletcapa un enemble member f the Nnet5bcnh Maieh Theatre fr Yung adieneu errgtly ply/g Gepptt in "Finadchin" He in pee/rne i turing hw fn yang peple m/tb neetan Eagle Fmdctin D Bandy he iege et Church f the tnement i Chicag "a ldied ga" Ellitt bded thi pendan/l 0/hy" "Thera arc u lt f geet yuung perfrmec in thiuhnw" timm fathrr /n 18peld aid "Thareb mething nemy baic ht having hild t/n/he nary irngaminul a/nrd" Garrrmrr/rpirrlaafcara (J Cnn/nert Tram PGE diera ll) tnls St EanntrSMl/ 075101f yeniiiteheilnuueílr$ lneled 2554115e te $5 utg 5222 rnilerltnenntedntddhiltren Hnl550r050tnu/ndadretnnitOlO/ tl5 n DU M/ geas &remeoa r )ird re DOS hnrnn 000eum tter amt ntümi/nrn t cad nirrnni nrduhphenehitrenieeçnln nint n t/yri kreiere el tr/ititrai lie/n 550nin nbjntnarrd ntae ientherhandr000etihtten/iemed/ rtieutterndeljienlteelfed eitlranntreendnnafre/tlreuernparttdpdnteenlbeennnu muet by un 01011 H prrnlhlrutinn l er0000ry00yeli00505t/)rer May Dr Tel Miri OrOnan nn iliili MnHh thtmebe#nderny alit O rlh lar Center nr he meriemtt Oil looisdinbliutdnhie len) 1)9mOti ae05rthirghlro 011erOg ru nn r p rtcieinq en nip tr etuledleieiradenltolaqirlrtlyin npretrn lampa ela$ojotr Cerp t gradan 3M Suna 75250v l/y dmap 7 leetilr$ et ir imprenlenlian end eutal theatre un qileuiei050c9iairip)n Ctri4arellHa/ren2eiHrtenp tyjrqr4f7gma4 plntatn0inee*tn t000deuinplàpntllhthntyn/ eigrynetlun 155000f tn/re d r Orlan teehrlqn bai twrkhen /m7radna 0fl Ja1414Oç$ $001riettetinelyhnctnr lrnnelpfijlr00ttpemayl Sipltarlannllpny4005p uni and fol p n May il ni the feenpt Tlaatra t4f$kgoer O Peennt1 0015 ll ert St pnado laid t rile nte 1er inmt 000illnlly002llernnniradeterr DNCE P54520005050 dlnrulenkeieruitlaart il Wrd Mrnl nri nner inri Cnraele 050ri MOSC n nid merder i t tia tu Rc THROUGH tíul ll 4017 e FNL 3 WEEKS! dru Sheedni nnkelen OS S 1er t nn/u lull 15471 loi5141 May 5 Dper Tela PerCer 000 The hng te heit nns Sheme ae rn 0a5 0/$3 t pmethayat2pnrynrrnnrd Shitt7lrirlarie len000 riekntnn U SS ter et0000tv 11471 4917285 0004PS&iEOS005 ttiaq Tea club lot 4024500 Oe000lninuie/rntlie O/etldun tie filrl/o pm Snlurle al pmrla tllen lati 9101 manil One ranklin Park Mtly unlt drn lt nene /aihianv li an tra Oerin$ pnnl000nulian/eldr nnrlnr;llarcneebernmnmtertpiull iannpdnlnnremem SS und J in 0 Ctte500 Windy rl Jtlertq hub tlt 11000e in ihn aur et the t kn and re ir000pnnoiqtlat le enima leo en rail 919) 4 namili OreirarlicPerl er ere mlhirrroeetn/ Oarnnrarinatal/arreu n ll er Sny tul in rrennani Orperatirre iu rrdmiennn nr ihrlr aul000 le he eri/ei teli 17121 OtTlTT nr irt nptlr hhraqur rlriln denmn are MayO/Merl Oetilenfrim BOPDW«! i mliii i cri r i riirll 1 ir irr lull i lìii Stil b/nepth"t"r r i Grap Djuuul lee Mkiiy i 1mm DhWmtWn C/n/cagl Drury L nwwtklçetflra5terwm 312 902 1500 www;dñrylanealbrkcöm Oakbrk TOPL 6305308300 i dene cnventn S$4 lll 5 hlllyeleltthewebal//erdeluitu Ola LMe SannO CanSa 515 L The Oder nh nomn nn le/rmetlen Seil 15471 824000) r 15471 8DmuT Nay $ and DO 0lS p 01 tine Leny ni ihl bulbu du nile/aped ul SS pr uple nl the dr Mey OQ5iO100nOline Lenynrillt tltrae 250000 t li nd 525 per n pi at i deem 15000e Spem & P/r 1050e Si 10M a le ter crepn aed 5ma00 denneelheean050ndia4hmn /aye el the eenth ali year t ng at hn Park 4145e nier Cetr ic t eryueprdmdpe500duiar/et 05/pe lthnpaarnelrnvilpe 1er relniatir ell 1712) 7710007 un Tll 4038000 Me9ltnldTyee w "Ove f t/t grea/ut $$0$Ta/ aplif$ctl liii 04/RS it MBiStbCb t bull L1TCS0 Cevlè New Yrk TimeD MRCUS ROBERTS pirr ROSONS StEt/id 01150 1050M MRLS dioa MORCS PNTOP ranrimne RON WEETSY Nli000 WFSS 5455552M lllmraairlir O7EUEM fllletii ;rnay950e nyrarrlreymndaeyyeleh Drae elleaeee000rerprçraer Tente Trnity tantrelnlanenrketnpin dnnlqrrttnlnlrndbb0500hrle aqee l12 te the cand nl nch denen Parlinlpa/e mit leery n hacen el rih drmo 104101 n pruner techniquen nl 5 ennent et t rhilyn el rih nalc9u p000lt ale cepnriee le 0000unarn eccine mt be hnlojaamjaoy$ardsyswuflh attnnlrihorrtaelleni/atecentec On2MMeeChluguCnat pernie elue uaaul le 15h ht blade a TnnityiehirtReqlnlretinii prtrnenm ali ll/i 005401f nd 35 rynticaetileiirylrrdlydireee fr ntnreetinnini/000nlriityitnli FRS & FESTLS Ment H heuy000mrtnee prenenl c/nih Omeriannntetye/Orliete lrmbamn5pmmayillndçee r Park ll S lrland Re rk Silg Free /cinema Call 15471 l4704 erinit 0000e ae)aenninlylrliulnrg $nysktdefoamnlaufhaeuents mtpmaydtta/oentntark 4lmwaekteleMe/alnln ethd lulk t and dare a ni/n rang al rnd ar/n and rull n/em tleyalehittrnne qamenmhandin baaanant1150eyu/atleateenlhn ara dinpler ieeceknkrneblrltrp ge PGE BS FRDY MY 8 8:90 3122043000 150ORG

814 wwpiieedcalcm THURSDY PRL 30 2009 PONEER PRESS PUBLCTON wwwpineerlcalcm div&cm:: BiS NOW PLYNG thrugh JUNE 7 2009 f j ;dni rtit Preent i ) Supertar Ted Neetey tarring in Jeu Chnl Supertar pril 30 t May Z t the Rernarir Theatre 5400 N River Rad 1icet pt $35$69 iit wwwtichematecm r call (800) 7453000 L p R L Buy Ticket Nw! CLL 8476736300 OR ST nrthlightrg * a : 0 1 P D p ; k : p g" Cntinued rm PGE B13 FLM Blck Cnema in the PickLaudati uditrium at the Blck Mueum l rt Nrthwetern Univerity 40 rt Circle Drive Evantn (847) 4914000 wwwblckmueumnrthweternedu/ blckcinema dmiin $6; $4 (r Blck Mueum member enir citizen and tudent with D r a nted belw ll film hwn at 8 pm urfle nled therwie May 13: npire Film event "The Cae (r rael" "Rape and "Perverin f Jutice" May Zt "Snic Cellulid" a cllabratin f WNUR Nrthwetern nncmmercial radi tatin (893 FM) and Blck Civema The event feature muician perfrming live muical accmpaniment t ilent and experimental film dmiin i $10 May 2 Nrthwetern Student Film Fetival Grdn Park e rie pril 3D: "Half Pat utumn: The Life and Wrd f Grdn Perk" May &"Shaft"May29:"Slarnrì Nrthrup Odyey" Blmimlcry erle May 6: "Ght in the Shell" and "Ght in the Shell 2: nncence: May 15: "RbCp" Talkinç Picture Fetival May 1 6 pm: "1000 Jurnal" May 1 8 pm: "Treele Munt am" May 2 1 pm: nimatin & Shrt Shwcae May 2 3 pm: "Pray the Devil Back t Hell" May 2 6 pm: "Ol 0ff Bradway: May 3 1 pm: "Site Sing the Blue" May3 3 pm: "Hilal 1960$ Gdarderie May?: "Band f Outider" May 14: "la Chinie" May 28: lphaville" Park Ridge Public library 20 S Prpect ve Park Rldge(847) B25 3123 wwwparhridgelibraryrg Film the Library N regitratin needed Dr pen (r earing nehalf hur befre hw time May 8 7 pm: "Cri Cr" (1949):May 12 2 and i pm: "Slumdg Millinaire" rated R LECTURES rih mercan Hertage Center 4626 N nòx vechlcag (773) 2827035 wwwirlhamhccm May11 2 pm: "The Tinker in rih Literaturv" pr enled by Jé Lantr tinker i memberf any traditinally iliverant grup f peple living epecially in Sctland and reland lantr will dt cu tinker character in rih litra ture and cntrat them with gypie in Eurpeanand Britih literature in particular $10 include a receptin ORGNZTONS De Pl&ne rt Guild meet at 7 pm n the ecnd Tueday t the mnli at the Prairie Lake Cmmunity Center 515 Thacker St De Plaine: New mem ber are welcme Fbr inlrinatin call Margaret Newman (847l9248952 r viit wwwdpagrg May 12 Thelma Spain will preent a waterclr demntralin Park Ridge rt League meet at 7:30 pm the third Friday f the mnth in the Suth Park Fieldhue 833 Talclt Rad Park Ridge Guet fee i $3 Call Drthy DuSld (847) 8253505 Skkie rt Guild meet at the Skkie Public Library 5215 Oaktn St iitr welcme Fr inlrmatin email na Marlwe@gniailcm May 26 7 pm: Lelie Riley qulltmaking TOURS & OUTNGS Rçer ParlWet Ridge Hitrical Sciety 23rd annual Hue Tur will be held frm 15 pm May3 The tur teatureile in the Germania and Eat lake Terrace Neighbrhd between Hward $treet and Juneway Terrace and Paulina venue and Lake Michigan Regitratin tart at 12:30 pm at 1643 W Hward Street and cnlinue until 4:30 pm Ct i $20: $16 fr member& The tur feature cmmercial building hue garden and cndminium including the lbby f the hitric Hward Theater the Bradmr Hlel the Bihp Mall Building the garden and pier at Nrth Eatlake Terrace an apartment building and fur hue n Juneway Terrace wwwrpwrhrg WORKSHOPS & CLSSES MSCELLNEOUS Oaktn Cmmunity ClleQe Emcrilu Prgram ffer cure at it Skkie campu 1701 N Lincln ve Skkie Fr inlrmalin abut the Emeritu Prgramcall (847) 6351414 r viit wwwaktnedu/emerilu Thumb Up Thumb Dwn lum E7472) allw film bull t gather t critique the latet mvie Furweek cure meet frm 13 pin Friday tarting May 1 Cure lee i SSO The New Yrker (hum E93 73) lcue n electin frm the magazine that wa etablihed in 1925 ubcriptin required Threeweek cure meet 93011:30 am Mnday tarting May 4 Cure fee i $39 ET CETER "Dream: Circuí n One ct" thrugh May 17 at The ctr Gymnaium lcaled at the Npe Cultural il Center 927 Npe St Evantn The family riendly circu prductin include acrbtic cmedy and live muic Pertrmance at 7:30 pm Friday: 4:30 and 7:30 p m Saturday: and 2:30 pm Sunday Ticket: $20: $10 fr children 12 and under Fr ticket viit www brwnpapertícketcm r call (800) 8383006 Drum Crp nternatinal "DC 2009: The Cuntdwn will be hwn at 1:30 pm May 13 at lhe Nib Shwplace 301 Glf Mill Center Nib The event hw cae ix f the tp drum crp perlrmance frm recent cmpetitive ean fllwed by an interactive an vte Ticket are available at participaing theater b llice and nline at wwwfathmeventcm Park Ridge Public Library 20 S Prpect ve Park Ridge (847) 825 3123 wwwparkridgelibraryrg May14 7 pm: "licia: Stry f a Plih Nerme" preented by prfeinal actr Betey Mean May19 7 pm: "Wrld War l Radi Hur" Skkie Theatre Muic Fundatin preents cncert and prgram n the Skkie Theatre 7924 Lincln ve Skk le Call (841) 6717161 r viit wwwkkietheatrecm May17 1:30 pm: "Lln cin Tale Tall 6 True" $20 in advance: $25 at the drmay 1516 B pm and May17 2 pm: Chritpher Carter Mee With Yur Mind $20 in advance: $25 at the dr May 2223 and 2930 pm and May 24 and 31 2 pm: Jim Pt "Mark Twain and the Laughing River" $25 uadvanc: $30 at the dr $32 i $47 i $57 $67 $77 WXOE&K TMES 4 PERFORMNCES ONLY! May4&5 May16 May17 7:30PM 8:QOPM 2:00PM FOUR ESY WYS TO PURCHSE TCKETS Online: fìcketmatercm Phne: 800982 RTS(2787) n pern: uditrium Bx Offiçe 50 Eat Cngre Parkway Grup 10+: 3 1 243 1 2357 UDTRUM ThETRE OfROOSEELT UNERrcv auditriumtheatrerg 0k; bmh w Qngn Mari bahv i TaHna phi by Ol Ziv

r ç R16 wwwpineerlcalcm THURSD PRL 30 2009 PONEERPRESS PUBLCTON wwwpineerlcalcm ml w lwwu 57TH STREET 4N0 L4ESHRE Dpj *CONENEtT NDOOR * 73 6S414

S 2 Cmpnent e 818 23t That Eay! lhcrç1s nvr:fr 1&aifl by 11rida crc l) 7j uury pl hme ctt t) itractjinu fii S991n1 Jut Cfl 2 i)øl3sa rn thy He cnin flm ri nhilwc WC Guarinte li! 8OO267l65 r wwwflridalejurecm Timehare Reale t SO t1rtj }ki Jkriç & (ru fr j kl iinur Migazind 8003541316 iiwhlidaygrtipcrnfcii 2BR Cnd Mjute frm Diney Slccp Nitcin & aiindrv FL1jlitç Wee3h fleijl frifri r Call 8478351715 fr vail8biluy Greenbriar Cuntry nn & Suite Galeiia Skp bid in lioe FeLix in hiiric dgng rr1rj rrhirjjj iiibc T% ddjrcrrj hrrjktaçi brçkt t urir dr Wik i rciarirot hp Midwrek peciil l8157773153 1The dult Ecape WWwerenjtyprjnC0 rrn21ç erknl toflun turgakrw 85 xrp (tunii $Cin trj ihtij1 (r 1 eicntijcwniij timrsnrçuir T&liiO()Nt nc dihlc pun rrkn41o frceult?urge \iuhipn Cii tn 2198610000 LlÙ(EíìOÑT RESORT: Spring lireak «u Olin tgm Oct Our Nini Fr«Kidi Su/c lier ikni Rme &dnir\lrll fl!eljur lutter ndr ni u hurler Mllet) iirlenj Mnuh 2729 wwbaypinteinncm 9l888GunLakc Ml lke Geneva lt lway been the Place! Fergzthcnng drtringihe quiet retin u cnr brai the brauiiíul Like (kniai anca l)intig th;ptn cru rtaiifl and innianru arc all hrj 90 rhlnuic ntij aadbjrnfajl illeec arr OJO ilne (lting wiry nt labt a breab nj ewa i beautiful l$r Gra;rnu deime t! ldiilt n elltijtrmaj«vwtnw Picue nut ur wçjj 61e al wwwfakegenevawjcm rh uat 18003451020 RER RUNS THROUGH T! Suite n a circa 85 tciivaieaj iir flur uruøl Mnywith whl fireplace 6 Over the Ec River trudy unique n ldd deiijaii uiide Green JJa laine Sucri hin 201 Jame StDe Pere w: 541 5 Call fr brthw l8008978483 ; t nnd; rert t?ceurlhiting in th new DeinutjJn drarnuaf b ptime ; : ; hòflefr4ig Gazian; (847)486fl47 r il9vis (1:\u SOHOY/HSEtR FOX PtTbune Hthidëv C&1rierNe Naperville5un t PONEER PRE DOÏ1S Wwwpjneerlcajcm CROSS i Ryera remark 5 Pleat 9 Plead 12 Wden pin i 7 Baeball izquei 18 Prtrait painter Jhn i 9 Pakitani language 20 Flaunt 21 Small hawk 22 Decarte r 23 Truting rt 24 Lath 25 1 Think t Lve Yu grup 29 Khan piner? 30 Fig 31 Fter a ttn 32 vid an accident 36 Pij cntractin 38 Way it bae? 39 Pixie 42 Jy t the Wrld grup 46 Swimmer Thrpe 48 Supper crap 50 Meat cut 51 Fíx a tight 52 Mercury fr liii ne 23 autnr 81 Sur 82 bdy r Mutdn 85 Muty aß rn Mike" 87 Onai nickname 88 Herme mm Supér Crwrd 54 Dwight 89 Ruell r DOWN 35 Stimpy pat cmpetitin 81 Rel Wahl Hunan pan 38 Prtectin 55 crn 82 Java jirn 90 WWlt area Skip eventually 37 Change ib 92 n 83 rt medium 3 nauguratin 57 Enthuiat 38 Lawyer 84 ctre t GaddaDa Day event 59 Trite cae? ida" grup manda 4 Liberat 60 40 62 Kubrtck Break" 96 Rcker 86 Friendly Scrunged film iland arund 41 Cmper 87 Nvelt 6 Beethven Cear Kb wrte ne 43 Rcc 8B (91 film) Claypl 61 Directr 98 They may Kazan be plit 62 Siter l She width 63 mntillad ii Evaluate cntainer 102 Svaeattiirt 66 Yen 5 67 Happy 104 Btanit Tgether Gray grup ia Bird 71 Her G feather gain 107 "Fr What grup lt Wrth 73cre grup Lilli 114 mam 74 Line f Subject Clthing? 116 Skeletn 75 "Tha part Slrnpn" 117 Crdetia r bartender Edith 76 nît)o Bunker venger" iia Sink r tar Swim? 77 Wan 120 Bundle 79 "Ml 121 alley Flander" 122 rund" ib 22 (64 hut) 123 Ntin 124 Cabinet wd 125 Canal zne? 126 Wrd with biuit r jerk 127 Suburban ben 7 Navel 44 Fed S tre? Dubtfir& 45 Party (93filni) BMailer "The animal? Parle i Baba rl 47 Dze tne Byn 9 Bettr 4g Church 93 immnent neelf in a tfering 94 Lutru way 53 Jal fabric l Falc et 55 Nthng 95 Mrale f The r La Bambaa Spran" 57 Winter 97 Channel il Lud laugh malady 99 Genei 12 Carg 58 Pretenin dltr uncie 59 Kramden 103 Out t get l3threat vehicle 104 Edf"Rla WOrd 61 On f the ONeill" 14 Guarded Barrymre 105 Extend i Mag 62 Dwnfall acr bigwig 64 Channel i S Glfer i inpected Trvin 65 ctr Duila t clely? B7Cuntry O?Tweeter 19 Rever Singer 108 pdrda 20 Richardn Diana 109 Spring flyd 58 inn flwer 26 Macadamz 69 Petrleum 27 Cr 110 inperative lii Depraved incriptin 70 Chatterley 28 Extremely ll2wan r wa her ht Windermere wain 32 Nrmandy ii le met 113 Sketched ite 72 Bilk rank: 114 Hydr 33 "Hld yur abbr hrt" therapy it 75 Nntere 115 Prter Or 34 Paltadin f 78 Brn Prince "ER" 8 n place f 119 Outlaw 9 10 i 11 J 12 13 14 15 16 iïïïjjjïi iii d t 39 40 41 47 48 4g 66 i1ii:fw!: 82 83 84 8g 56 dr i197 107 _aii_it 5 8 10011 li_ 102 103 104 105 NUROB 1O911O lt2 113 llui 1i ui fi 00J Kng Syndt nc WOitci right reerved nwer: nide tbday"clajfied ectin THURSD4ypR 30 2009 Pineer Pre Publicatin (uc) Cndn Patrici Marie Patricia Marie Cndn (flee Brnder) f Park Ridge Paed away pril 27 2009 Belved wife f Jhn E "Jack" Cndn; lving mther f Jan (Chuck) Bende Pricilla Maiewki Jhn E (Jan) Cncln ll Tm (Lynn) Cndn Rbert Cndn Liz (Jim) Fraie and Patrick Cndn; dear grandmther f Jamte Tdd) Kendall Tracy Fltz Kylie Cndri Jhn Cndn llin Bende Becky Frate Billy Cndn Matt Cndn Jeica Cndn JJ Fraie Maggie Cndn and Charlie Majewki; iter f Carl (Barbara) Brnder and the late Tm (Mary) Brnder; cuin aunt and greataunt caring friend and mentr t many She wa mt prud f the Park Ridge Garden Club Beautificatin Prgram which he rganized fr 20 year wa patpreident f Park Ridge Garden Club She erved n the State Bard f the Garden Club f illini Named "Outtanding Citizen" in 1990 by the Park Ridge Jaycee fr her ignificant vlunteer wrk PatPreidGnt f the 20th Century Club n Park Ridge Parihiner f Mary Seat f Widm Church ince 1957 Named "Wman f the Year" by MSW in 2002 Enthuiatically erved n parih and rchdicean Cuncil f Cathlic Wmen charter member f Guardian ngel Guild Memrial t Park Ridge Garden Club r Rainbw Hpice appreciated iitatin Thurday 2 t 9 pm at Neln Funeral Hme 820 Talcft Rad (at Cumberlnd) Park Ridge Funeral Friday 9:15 am frm the funeral hme t Mary Seat f Widm Church Ma 10 am nterment Twn f Maine Cemetery nf: 8478235122 r wwwnelnfuneratcm Sin (;ixtbk n Fabiunich nthny J nthny J Fabianich 80 year 52year : reident f Park Ridge paed away Mnday pril 20 2009 nthny prudly erved in the :101t irbrne durinn the Krean War Deeply cmmitted t giving back f hi cmmunity and helping the n need he wa a vlunteer driver fr FSH a member f The Elk and adrer fr the Eucharitic Chapel at St Paul f the Cr and a fundraier fr the Church chl additin nthny al erved a Park Ridge rt League preident fr five year Huband t hi belved wife Lrraine (nee Ptk); dear father t nthny Jr the late lan Mary (Terrence) Hanney Laura Camern; cherihed grandfather t Sara Jhn and Curtney Camern Private memrial ervice t be arranged Memrial cntributin t merican Cancer Sciety appreciated i1i Gflexf!()! (U FMLY OWNED & OPERTED SNCE1922 11E RRNGED & PREPD FUNERLS LBLE Cney Funeral HmeS FUNERL DRECTORS T Be rthy f Yur Cnfidence 3918 W rving Pk Rd CUCGOL 60618 Phne (773) 5885850 Fax (773) 2799802 625 Bue Hwy PRK RDGE L 60068 Phne (847) 6851002 Fax (847) 6851005 wwwpineerlcalcm Sargent Benlamin (BO) Beniamin (B) Sargent paed away pril 19th 2009 at the age f 80 Survivr include Mazie hi wife f 56 year; and three children daughter Suan Kaye (Dan) f Nrthbrk and their children Jeffrey und Kritin; n ndrew Sargent (Judy Eichmann) and their children Matthew Emily Zachary and Tm; and daughter Betty Sargent and her children ll and Sahar MirRaekhian memrial receptin and dinner t celebrate B life will be arranged thrugh Stnewall Orchard Glf Club in Graylake at a later date Memrial may be made t dvcate Hpice 801 S Milwaukee ve Libertyville L 60048 r yur lcal fd bank rrangement have been made thrugh the Crematin Sciety lmai Siga (:u9!!?l rit May Dnald W Dnald W May age 89 frmerly f Park Ridge and Marhfleld W recently f Hnlulu H paed away pril 16 2009 in Hnlulu Belved huband f the late Delre (nee ndern); iving father f Kritine (Raymnd) Barry; dear grandfather f Curtney May (Evelyn) Barry; dearet brther f the late Rbert (da) and the late Harld (the late Gwen) May; fnd uncle f Kurt llan Keith and Greg May; gdfather f Nancy (Rich) Hlz Jenkin Service were held Mnday pril 27 2009 at St ndrew Lutheran Church Park Ridge Burial in Twn f Maine Cemetery Park Ridge iitatin wa held n Sunday pril 26 at the RyanParke Funeral Hme Park Ridge L Dnatin t St ndrew Lutheran Church are appreciated Siiii Ciict iiiiik a t gaiii:jiuiceiiacaeiri Schaefer Jr Jame W Jame W Schaefer Jr belved father f Jame ll Tracey Meicher Thma (Mariah) and Jhn (Jennifer); lving grandfather f Keith Man bigail and Samantha; dear frmer huband f Marlene 30 year drummer f "The Riverbat Rambler" a traditinal New Orlean jazz band mem ber fthe Phi Kappa Theta Fraternity advertiing directr f "The Quill" Retired funder f Prfeinal Superviing ciate lng time member f the Park Ridge Lin Club and Frmer Exceutive Directr f the Park Ridge Chamber f Cmmerce Funeral wa held pril 23 frm Ryan Parke Funeral Hme 120 S NW Hwy Park Ridge f St Paul f the Cr Church nterment Twn f Marine Cemetery iitatin were held Wedneday n Lieu f flwer memrial may be mde t the Jazz ntitute f Chicag 410 5 Michigan ve #943 Chicag L 60605 /i 1iiil /ijaj; i itu jiiiuttii aiti 7 f Gerber Fred W Frtr Fred W Gerber 92 f Mrtn Grve paed away Tueday pril 21 2009 at Bethanv Terrace Nuring Center Mr Gerber wa brn in Mrtn Grve n February 25 1917 Hewa the huband f the late Katherine H (nee Randell) and the late nne (neè Hutchin); father f Li Gerber Linda (Jerry) Klinger and Fred (Marina) Gerber Jr; brther f the late Chrit (the late Mildred) Gerber Service and viitatin were held n Mnday pril 27 2009 at Jerualem Evangelical Lutheran Church Mrtn Grve interment at Ridgewd Cemetery De Plaine L Memrial may be made t Jerualem Evangelical Lutheran Church 6218 Capulina ve Mrtn Grve L 60053 Sii Gntbk ut 1i:gr::jiiniirirni Ragel Jack W Jack W Ragel f Scttdale Z paed away pril 22 2009 Brn Octber 6 1925 in Marin L he erved in the US rmy during Wrld War l and wa awarded a Purple Heart and the Brnze Star He had a lng career a advertiing executive in Chicag and later Madin W a CEO and chairman f the bard f Stephen and Bradley befre retiring t Scttdale He wa the belved huband f Jan; and lving tep father t Rann Bleyer; and lving grandfather t Rann Bradley "B" Bleyer Memrialcntributin may be mude in hi name t the Leukemia Lymphma Sciety PO Bx 4072 Pittfield M 01212 r nline at www leukemialymphmarg!igit (;i:e!ìk at Yu may end a death ntice t deathn tice @pineerlcalcm r call fr mre infrmatin PONEER PRESS Scull luau ck T[ a Thurdaypril3O2009 U RYN PRKE Funeral Hme i 2Ó S Nrthwet Hwy Park Ridge Suburbn (841) 623Tll Chicag (773) 7921811 wwwryanparkecm

B Thurdaypril 30 2008 SO roleg Cl Stre 930 \lkle liw: 9:30 ne440 pieles dfreec3701 W Llc Se Clem Pi ns Wreerjniee Orme Crl tti mr OS ur ed S SSn tsmymu Wet: 2p lueday Cnul: O:JOpm Teuday tre: 3p TucdW Seing: 4pm lotero1 SOeSt: Srm Teendep Leg Sd: 300 re Cctnifled3inrleetd:0OOpS\l Lerrrk: OOOpre 05e Ceint d: Seur!lererren)eed:lí : Srer Cíejli er e ::r:ilicd reír ;000dtc0ì0: rer Cree Ten Oíerjeí e: derdíhe ì1ireud 4 e r eeeeíe )ÇL ZNl Height Cent al wwpineerlcaicm Stll Ye/e/r Rc; inwu/ rei r: 8479903400 ptin 4 lr: 84748572(1) rrcrilllan(ldpic leciit ThJr/rr Sir/ i 8479903405 pesan 2 : S47SS(r74i9( t lcrriíicl (r: r j rl r ip/r rí: ietpr/ 84799g3400 O5rEiOfl 5 li 517(8(7e)7 r: il Cej lir l ri i Thp/r 0479993 tpafl t r» lríít r_rl OSr S 8479953455_ 05510m 3 " ill /lírlr//r Pianeer lre Pblicatin (Dc) PONEER lurss mnter (law werkig Killt (better ptneerl001cnm/nienger rmuncementy liuine Directry Hrne Service Emplyment Rentai Real Etate Fr Sale Marketplace Sprting Mart utmbile Legal Ntice Elvauft ltry 100 200 300g 400 500g DO 700 POD SOD l000 Clumitilm 2 7 Pineer Pre Publicatin lac) EOrSiSE 24/7 PONEER PBLSS lie!opn iipit rtelkg: neciatiied it the pine l r yal rnweepianeerlaealcatn C(aified venue 300 arenera E) i 8a agli / Thurdayprí1302090 J 025 nwer t Super Crwrd ]!M1 OflE fll! fltjth E:UND 1! Qfl1fl UD!1fl0D WM1 FW11QflU re1f nrn mmm mmmix me!q ndmrim mmm mnmmmmofldmfl umm mim mmiim mum nmm rimtmu mmm rammn mricintu mmnu muri mmci mm immun umnmuimm mmnmmuio mmmci nimm mmm mumm liflhl]l1 inim mmmii mmm minm fjflc!cj UmJh1 OciD DODO mm OBfll liflfl ldim 000 L1flOflfl immm nm nn mummnnmmunlmlrn E D ODDJO imdfi ]CU t 0 0 [R! OEM M!]Ø K 01090m DOD 00100 1010 Clai venue Claified venue 1999 n OeiSg Pinner Cirru? i the pie r yei Claified venue Dnt Replace Sunken Cenerete RSE TS 4H Pììa CONCRETE 1015145 Expert 8882289060 TzöflO Nbeutll Wmb 9002261096 J88849 J5625 alue Pack floottlf 0n00ee5!i 5 te Oittei(t000? 6307050200 WE W t tip ban n El O rw b:ri ir l WOHN SEEKNG MEN MEN 5EEKNGWOMEN Fenue Siding Wall Cncrete 10% 0F j ulthlhltlrth j tp 35 2059 Oi) Trna 7733174121 Ca Tday!! epedble Relitti 155E EtiSSteS Save n ir Cnditining! We Service & ntall ll Ppular Brandl ir Cunditiner Furnace Humidifier Electrnic ir Cleaner Cli Mike Spring $ptilali 7739356050 ie cnditiner BRTLEY"S Clean & Cheek HETNG & COOLNG SMg YerCrntnnit5 ann 1965 CLEN UNT S MORE COSTEFFCENT 24H Serrín Fm Ee Fully leedd/ir BTHTUB RESURFCNG iptemhtrbd*plttttno pt5&nertttirrrr? DONT REPLCE T! GE UP TO 90% OF REPLCEMENT COST ennui Cnn mee? Omet4 bysoye rnfle r Feemllete 847298è989 : rl ll & Cttfl005p $20OO OFF NY BTHTUB WHEN YOU MRNTON fln canewuf986989r i vi Mtecurd & 0 nnr

Francican Send B Thurday prii 30 2009 Clean Service 316 ClaJcj venue *REDUC YOUR CBLE BLL* Gcta4Rm il Digital Saielllt Sytem l Stalled fr FREE and pr Ormming toitjpb UfldØl$7 FREE DR arci HD Upgrade fr new caller SO W SLES Bankcad: Ep Only Weekly ncentiv Lifetime ROSiduøl Mnagem lenhial With Bflfit P & Cr llwance i07 18005973140 ext SEUJRENT YOUR TME SHRE NOWl Mainte nance fe t higi? Need Cati? Sell Yur Unued lime hare tday N cmmiin r Brker Fe Free Cnullafianellatlm harcml8647083d Take the Belier Life Pharm cy Challenee Make Hugø Saving On Yur Prcriptin Medicatin Fr Quality Prduct and Belier Service l? med4lebettrllfe Pharmcy Cmputer Elecfrnic Svc #1 PPLE SUPPORT nternal emali pht ppewrk crn (847i27875 CmputeRee COnultng Technlgy lflstllt155 repa» & tulring fr hme 8 Sm buine 550/hr 20 vi exp 312238932 WwWcmputeree Crn Health Service 236 ONLNE PHRMCY Buy Srn Ultrm Firicf Przac Bupar 57199/90 510711g Quantifie PRCE NCLUDES RESCRpTON Over 200 med $25 Cupn Mentin r ter #2i3ì We will maid 10082691982 trldruoire int lme Service 300 ir Cnditinlnj7 Heating 304 Five Star HOting a Cling Service 8 lnstaiiatlfl Free Etimate & 24 Hr Sery 173327755 PLuS Utlng & CltnB nfat Sglcg Repalr Watjhgte 479ppapa7 BuilderT Cnträctr 310 J847679786O NEHUS cntructin C General Cntractr 24 Yr ; CÇflflfr)l CaDnetwrJ CRPENTRY by SMN Tll Remdeling Bmf Deck Pjnlig 84727487 Halina Maid nc Team f 4 8476fl47 Çleanjnj erwce HOME beljh NC Cienig Service Detail Oriented ftrdcbie is Exp lnjbndea Exc Yr 31296l09 Rei 77342$2676 Cçqcrete Brcicwr( ny S Cencret Jb! 40 Yr Experience Call Greg@ Ml4219202 CONCRETE ETC Drveupa tep ar F r Excavatln Fufl«at ini FOUndatin CrackCn9 Re lpatchwrk 847 760212 CONCRETE STEP REPR & RESURFCNG PwerWhin0 Staining il hm rqpair call Jerry Free et 773732t98 Cncrete Wrk RE ROHDE & SONS Cemenf Pati Gar000Flr Sidewalk Driveway FUndatin Fting Expeci ggrega0 Stair FREE ESTMTES Licened BOfldedlnured 7084537753 8476782O MOHR CONCRETE CONST il Type f Cncrete Wrk S3Odlijzing in Excavatin Faudali5 fr dditin Crawl SPaceBbcl Service Licened * Bnded * inured P: 7738507555 F : Natinal Brick Cncret POli Driveway Etc 8474332157 Deck 321 _; Drywall 323 Drywall CNTERNC Tapine CmmlRe5 Plater Bncject& n Free Et Mike: lo84567t71 JKE THE WLL DOCTR Repair Skim Cling Drywall Planter Free Elimt?3398743g XCS WLL WORKS Repair/lt Phae f Drywi 8472975441 cell 847414547) Electrical 325 45 Yr Exp Re/Cmm Satifactin OUrnf0ed Et Small ibcll Free 630893)39ß ei 08774p243 SPRO N E2pD ELECTRCN Lking fr de wrk l bg r mall FREE N lb EST 8472241084 Fencing 1 1 FENCE inc Nw & Repairil Typ 708452121g NORMS FENCE 4OYERS EXPERENCE ll Type r Fence & Fence Repair Railing 8 Welding Çaii Fr rq Enimte 7735892246 cø Flr 337 Flrng Prfeinal DutPr0 Sanding 8 Refnihing New Fiar nlalialin Quality al Lw Pride insurd_llcened_bnded Winter Special 4719i7912 Flr By Tm Sanding Staining intall 84725565OO WhOFdweedliøøymc R P K Hardwj Flring Sncilflglntaliati0 Repair 7086500079 Sanding DNELS Repair FLOORNG C Finihing ntai101in inured Gd reference Free Etimate 7O8B671 01 Excellent Flrng nc Wd tiger ntallatin & Repair Dutig Sading OUcble Flnih 847y41g6) Furnitjire Jepa Reinihng tfrtjgbiy Refinih yur turn & kit cbnt back t like fwl 25yr Oxp8479274873 Gutter & DØwnrut cx & SONS GUTTERS NSTLLED & REPRED 25 yr Family Bu CLENED & SCREENED 1B47253le22 GUTTERS CLENED OFFDUTY FREMEN MKE: 847823S77 Handyman 344 17139733J57 CLL LEX Eieclrlcal Carpntry Painting & il Othr Re9alrq 1847965814 Rich The Hrn)dyman Gutlr/palntlflWcarpentry WWWrlchthhafldymfld ndy OnCall Pr Handyman Service NOT Handy? Cati nciyt Bnded & nured 8473283100 STEE the HNDYMÑ He De5 tll @ Lw Pricel Free Eprnpt _4746452 Hme mprvement c_j ROSE & SON 474S1959 Rmdddltg0t15 Kitchen Sldlnu Dr Windw R f EDGEBROÓK ÑC KitdhenBathBml Free Eilmale & Deign LOW PRCES 735938884 Kitchen &8af 348 FTH BULDERS 47Yegrg n BupJulin Kltchgn Bath 8 Baemn 847676i07a Landcape Nururie 349 BSOLUTE BEST LORENZOS Ltncfcaping nc CmpJg L0ndcp Syc 7732625441 LWYS CUTTNG LWN SERCE CleanUp Weekiy5eri0 eratin Fertilizing 8473619522 DRT CHEP TREE SERCE Tree Remval Trimming Stump Remval inured Frei etimate 2245958262 8474&51503 Grenmadlne Lan caping HGT tyle iofldgp05t Wwwgrenmnci)neJic cni O??51GREEN CLL TOrY FREE elima$g JOHNS LNDSCPNG Maintenance 8 Cntruciin SPring Cleanup Fertilzing Landcape DeSign C Member 749231a Mike Landcaping Service Lawn Care Pruning Trimming Cultivatin Mulching Fertilizing 5PyiflgM7845844 TL LNDSCPNG Cmplg Landcape Frc Etimate Service 7Oß772D6 tight Hauling 352 B LE REMO L COM Malr nin lunk cleanuti Baement attic apmt etc Remve 4yr f lunk in 4hr SOyd truck & ai n Crewi Relable 24ff ervice 847338g JC_ Haulaway 8 Cleanut With the right price (708) 6099666 h (LF HULNG SERCE Remval f UnWated item Frm Baement Grgn ltic Buine Cntructin Debri Demiltin li Tank RaflOble Rat Free Et Senir Dicuni 7736160979 8474094860 l0ver (Licened) llini law require mver t be licened by 111e liiingl Cmmerce Cmmiin CC number and The buine licene mut repective n the advertiement appear clumn in bi Licened mui have lnu mver Fr mere infrmallen n fij lac lb cn llini Cmmerce Cmmiin iri1 LÏiflz ck5 TheOlnggd Plnger Pre Nwepaper ;inting Paperinj Decrating 1047 2991005 1847 2220589 l FRTZ&SON PNTNG ExFreeEwqpeper FFORDBLE EXT PNTNG 5 Yr Guarantee Cali NCK 22?7 LL PNTNG NT/EXT Drywall Tile Carpgnty Wtppjrflg $4ß00302 r 2243fl$353 WWwpineerjcalcm Painting Peih Decrating 358 Hmetwn Painter bei;0 Etnrir Prp Sanding Scping Cuiking Wuc Bruh Staining & Pinting BflOrniflMre Paint 5 Year Wrlthu Call fr lnferjjç Encllent Ref Fully tnured wwwhrnctwaintcr crn 84787cJ 600 Platering 360 Drywa Plater Wafer and Mld Repair n Dug: 708453592) JKE THE WLL DOCTOR Repair Skirt Caling Drywall Plater Free Etimte 773398_743g P(umbing LCed) FFORDBLE REPRS By Rlired Plumber Fully inured Lic #055020762 Cell 7008)46755 8476741584 Bet Plumber n the Wridi ny Plumbing Sewer Prcb em We can beat any iible pricl Free Etimate 8475053535 JPG PLUMBNG LL PLUMBNG REPRS BG r mait Reaflabie Free Et Lic #PL15497)74332 8475l8j3p Rfing 365 i 8477149200 Rfng Siding Gutter Windw WWWttvndalerf ng crn OSMONDOW Reidential Sixzcill Rf Remval5 Repair 10 year Labr Warranty LiCOfld inured FREE ESTMTES (24;) 25 Sewer Drain Service ptic;t CT SERCES Swer Rpr & Rdctlng Fld Cntrl Ovrhend Sewer & New Cntructin Free Et 25 y Experience t 34915472 11 0 jyment CcuntS Receivable Skkie Nuring Hme 4Mqhaetnept Cmpany ek5 experienced ccunt ReCeivable Repreentativ ny Pern regularly Prvid Mut hve Healtttcare ng child car fr mr hn ccunting experience three der unrelated Children Mndicpte billing a Piu age un )3 Cubiect t ticen Pleae end reume ng by the llini Deerl hr@5latinumhc nel ment f ut Children ani y Servce Farn Th numbe CuChed include the tcmy6 wn chtdreg Under ag yu are unure whetter 12 i any Pern lited here ublect t licening pleae Cntact yur lcel DCFS 0111cc trhe MR GROUT REPR rä7 BTHROOM REFí&6ELS TLE/MRBLE NSTLLS EUROPEN CRFTSMN Tree Trimming 376 CHRS TREE SERCE Tree Remvat Trimming Cut Dwn Stump Remval Senir Di5cut Free Et n5 Chri DRT CHEP TREE SERCE Tree Remval Trimming Stump Remvai nured Free etimate 2245958262 Kelly Tree Stump Remval Reanabte Rate 7738956725 r 84749dgj Tuckpinting 380 i8476797860 NEHUS CONSTRUCTON Geeerlcntractr24yr5 i 8477245600 EDMR NC MK Ycm TUCkpinitngßr CR/Manry 8479652 46 BL COntrucj nc TUckplntlng Manry (773)5014880 COST TO COST CO Tudkplnting Brickwrk Chimney Gla Blck Wind il Typ f Manry Wrk t/lltnb47399)$ Di K TUCKPONTNG & MSONRY REPRS Cilimney Repaired Rebuilt Relined Free EM/Fully in HGH RSE WORK TUdkplnting Lintel Rubber Rf Brick Wark CailFrank p133922264 Win Wahing 393: 158 WNDOW WSHNG GUTTER CLENNG POWER WSHNG Free Etila 708351$335 Enplyte :4»: POÌtEERJSS 9055Lcez S0u0c5 The DOip anti Pineer Pre Newgppg Tile 375 41 1 Seek Emplyment Elder Care duit Car PrOvider Cm & G r 24/7 twin Bui price il Lct N Pe Eng5pkng Bndetnur 7Oß6yz5a * COMFORT KEEPERS * Exp Caregiver CH Live in cme & g Screened bnded innurd (847)2158550 10r emplyment call 847229 1015 Pl5h LOdyw/ilyr expr Eflyjpkg Lkng fr FT Care Pafln 7086997957 Wman Lking t d care giing far enir pern exp Ort ret wn car 7736853015 415 Seek Emlyment Huehld JENNYS GENCY Babyitter Care9lver HSekper Live Out Certified and Bnded 8475376469/94759565 Plih Ladywili clean yur hue Opariment (773)6153352 432 Opptie Franchie 89000 a year reting link and writing d fr Ggie Jin the iargel nilneadver fing firm itt the wrld Signup at: www Bettergrker ORG Puruant 1g the Buine p Prtunity Saie Law et 1995 every butne Pprtunity mut be reglteed with the llni Securltie Deprt ment Prtecl yurelf and get th tact befre yu hand ever yur hard earned mney bycntactlngth llini Secrtary State Sacuritin Department at tø 6287937 :uie J1ONEERPJSS Yu6 LOcL The Ding and Pineer Pre Newpaper Siding 367 k fr Efrciin & Darren r1 E N RD Pineerpre Pub1icajn (Dc) ERN MONEYÒNLNE We ffr hnet prven reurce upprt and fr SUcce al a very lw ct yur Healthcare wwwmartmarklg Crn Lking fr mm & ther Learn l Earn 23K pr m FT/PTBety 8472514915 Truclç Driver WantedBet Pay and Hme Timel pply Online Tday ver 750 Crnpciniel ne pplicatin Hundred f Otter t http://iiammerlaneib 44p Help Wanted ; FulTme BE YOU R O WN DOSS! The Gurne Manara tre i lking fr an aggre50 repnible pern with a Cl W COL Own 6 Oper al & hirwn Delivery truck deliver material Thi great OPprtunity cme wht Super Securily & Unlimited Earning Plentiai Thi i YOUR PPrtunity t wllt the #1 hm imprve wrk nn? cntrt i 640) Grand tw 7455317 Gurnee L 60031 440 Help Wanted Full Time Call Center Manager SPacialijed tranprtatl Public Cmpany lking S hire n Cali Center experienced prtln prfeinal baed el Chicag hedquae5 their Call Center Manager The a team f 000fltu in direct lume n high para peratin trunll hve Cndidate mut Prir rialecj call center lrflpertatln euperlecy and knwiecjg at call Center reervatin ytem preferably Trapeze Mbility management crcllnhin huma ervice r cali cnter experience nnprfit be very Ueful and would f the Chicag uthwet kflcwicd9e wet Suburb an i Pleae prelnrrect end reume t appl4callcentel@ive crn The cmpny i an equl PPrtunity emplyer Driver COL CRST MLONE New TermlniHgmmfld n Nw Signing n Owner Op Na Truck? Leae Purchae vailable NO S Dwn N Credit Check 80036666j Driver COL DEDCTED Team Ncjdtf Run frm Chicag MD/M Run T unciay thru Saturday BCBS innuranc E:STERN EXPRSS/ Cali Edn tday! 8668634))3 Flier Ditributr Needed Call 7735077400 Healthcar n Hme Caregiver Nrwd Senir Heiwrk Seeking Caring cmpainale and Outging peple f wrk wth area Senir t prvide inhme caregiving ervice Yu will wrk with elder in ham etting t prvide aitance wth daily aclivilie and pecial prahect Mut be dedicated l quality care reiatinhip and Service t the eider Ppulatin Experience heipful but nt neceary T appiy ubenil a cver itier and reume t: efliomfletwrk r (pleae nat Cargiyer in the ubiect) r apply nline at nrwdenirnetwrk rg r via US Mail t TTN NR 601620 ti Nina ve Chicag L 6863)2410 GOB LEtu& PTHiip Seeking OXpQpern t erve a lvein lati al grup hm fr adult With deveipmenti cliabllilie Mui be able Wrk weekend PT help al needed Exp a gd ref reqd 7739757777 Mr 95 MNTENNCE MECHNC NLES TWNSHP HGH SCHOOL DSTRCT219 eka FTindividualw/g miq f l yr cmmercial Otectricai exa cntrl inteiti5 & Prficiency in cmmrdial HC Huriy raler$3467witi excel benefit Package d Previuly pted in March09 pply nline SO WWWnehgk1205 Buying r eting Pineer Claified i the place fr yul (847) 99834ÓO Pineer Pre Publicatin (Dc) 440 Help Wanted Full Time Scheduling Crdnatr 4 1/2 DeyS (MF) 38 hur weak Seekng FT experienced ciredtllirlg peran deal cedldle huld havez EXCOCP cmmuncatn writon nd verbal) and peple kll bilily t crdinat chedule anni unin wittt client/taff Strng prblem lving ettttorioi rgniatincti cmputer kill Medical terminlgy helptul health care cxjryrlcnc a piu Fr int pleae cali 9:00 M5:OOPM MF 2nd Flr n elevatr bdng CRE nc park Ridge L 60068 wwwebldingcarecom 8416951400 : Brp:g r Ciicd the pact fr yu Healthcare 440 Help Wanted Fut Time SPEECH THERPST PRN CJE SenirLite a Premier agency tr geriatrc care ha an excillng pprtunity tara Per iit Speech Therapit t lin t Hme Health mani Eniy a flexible chedute cmpetitive pay & nupprlve wrk envirnment Reciulre current L licene 2 + yr p cmputer kill S ability travel thrughut ihe lp the nrth id t Chicag S nrth t nrthwet uburb Submit reume W/ alary expectatin: ibn@clenet 01 lax 7735084766 nnprlit en m//v/d Buying r Sefling Pineer Cafed i the place (r yul Phyiatrit (including Chief f Rehab Medicine) nternal Medicine! Primary Care Phyician Pychatrit The Tucala Medica Center ha vacancie fr (uiltime bard certified/bard eligible phylatrit nternal Mediclne/Prtmary Care phyician and pychiatrit Cmpetitive alary relcatin expene authrized Recruitment ncentive may be ffered TucalaL ffer a lw ct f living and year arund utdr recreatinal activftle alng with cultural activitie ffrdable huing; extremely lw prperty taxe; and a wide range f prfeinal cial and leiure activie Fr infrmatin abut thee pitin cnlact Dr Mark Nienbaum Chief f Staff at 2055542000 extenn 2209 r by emali at: marknlenbaum2@vagv See ur full vacancy annuncement at: wwwuajbgv?súte: fst FnvtCt fedtsmfra FRNCSCN PHYcNS HOSPTLLLe 1 myktwptrntpnrnh4 445 Help Wanted Part Time Healfhcare SkkleMednw B caching n nergetic creative pern t wrk will reident 3060 year f age n an uldr recreatin pragrm 1520 hur week Pleae fx renllnne t 0476260432 Orthdntic itantpt Dental experence req Great tatt tticc and SS Fx 5084751366)0 RCutuh4 500 505 partment Cnd Unhrnd Suburban dvertie 24/7 Cil toi) 9983400 Email ciaitleds pieertcaicm Online http:\rder plneericalcm Fax (047) 4567497 FONEERfRESS nour LOCL 5050cc t11!tiii 505 partment Cbnd Unurnd Suburban 3RRNGT0N 2 Bdr 2 Bath Remdeled 1300 mall pet t val SP Julie 8473221172 Beautful iew 01 Lake 10511555 W PRTT EXTRSPECL LOC TiON FRST BLDG OFF THE LKE S BECH NEW L DECORTED HETED HWD FLRS MMEDTE OCCUPNCY lbr $105500 T view apt call Zialk 1734150035 H5kSJtn773545b SO CHCGO 3SR 2D Updted pt $915 Priclng ncluded Excellent lcatinni RE llen 7003838080 CHCGO: Harinn& Milwaukee Clean 28R Htd Hdwct NC $060 1773)4306374 De Plaine1643 Thecker Third Flr 3ER 2B need lranp Ne pet $1000m MeLennan 8470250011 ON OES PLNES By Clny Cnd Jut Rendeied 2BR With Balcny Overlking Curlyd Free Laundry Pl Playgrund Tenni S BB Curt $1000/M 7734196494 DES PLNES Dwniwn Studa $750 lir 5875 Eiev bldg C/ & ht vail w r June 1 Gar pt vi GRE 8412971500 FOREST PRK Deluxe lar newwlndw 1011db cablel tle crptg ndry fach C indi ht & ga $739/ma Mr Lui 7083665602 FOREST PRK Deluxe 1ER newwindw bitch cabnet tile Crptg ndry ladi C nci ht S ga $739/m Mr Lui lot3665602 FRNKLN PRK2 BR ali nw carpet 5000/m utl md 8474557888 FRNKLN PRK Studi apt $530/m + $20 C ht and util nd 0474557888 GLENEW1BR Eat Side Spgc bright ht NC celi fan crpllt dry pt prkg $too n pet 8476987131 wwwpineerlcalcm 505 partment Cnd Unurnd Suburban Glenview LUXUR ESDENCES M Free n e cc Unit bbdrm 2 6 :i bgrm w full beth and indr pr ng Large batcny calin Kitchen inunii w/d Lrg utdr pl tenn clubtue Hi Speed internet Onte mgmt 24 hr amergacy mant Dni r cal 0k NcrMlr l945 l294 Starting at 1ER 51250 2BR 52030 2ER 52260 1½ m c n 30R) alley L Twer l mi Chelnut y Cil 1541) 9981500x200 Mn Frl 9:305 Piclure n eparlmnlcm Harlem Belmnt: Spaciu 2ER Oak Fir Pel 0k Ht NC Prkg $925 0473380983 HRW000 HEGHTS 35 Rei Garden Heat ncluded $695+ne m ec 1737363529 Harwd Heigtil 3BR /l B 2nd fr newly decrated Reaenabie Cali 708667SeS HRWOOD HEGHTS Harlem and Lawrence 2nd ihr 2br iba appliance bul ht water and cking ga nc Laundry fac 7084565391 HGHLNDPRK 2BR w/terrace cle t dwntwn SuSO/m Cali 0479625648 MORTON GROE mened 0cc 29R 213 dey bldg 1 heled ndr nrkg p il pptc md w/d n Unit N pet allwed Near train llln 2 yrlae $145041555 8474708100 Hile/De PlaineGlf Mili Lcatln28R 158 Cnd mmmcd pa reerved prk C/Heat $1100 + dec call Greg 8472146190 NLES Newly Renvated 3br 1Sba all appi C $1250 md HET 8476350982 NOR R 06E Le 1 BR 5685 + utl prkg md nk abut My» Speclalli Newly dec 5 crptd appi NC Lndry gvl(708) 4534980 PRK RDGE 0e theflrt t enly thi newly remti 2BR ib 6W fir granit Grt 10cm avl 04Ol 5477789035 COME GROW WTH US!!! THE SSTERS OF ST FRNCS HELTH SERCES have partnéred with a elect grup f the mt talented phyician Our 55bed hpital and utpatient urgery center i eeking qualified candidate fr the fllwing fulltime pitin: Directr f Nuring Lab Manager MS Manager nfrmatic RN 1C RN Lead Lab Technician Purchaing Manager reume t: Phyician Hpital LLC ttn: Human Reurce 701 Superir ve Munter N 46321 Fax: (219) 9228674 505 partment Cbd Unurnd Suburban PRK RDGE Delu apt 2br iba ppi /C carpeling trage exc bc 8478251477 PRK RDGE: Deluxe pt 2BR 20 ll ppi /C Carpellng Strage Off St Prkg vailnw N/S $1075 Ebec 1847)8250555 PRK RDGE Reny 2BR2BaBrlti Ct Gar/liegt nch $1395 (841)3842031 RER GROE 1 BR Ñewly Remad Cenrl r Parlcing Space S15OMa (6301 0573830 River Greva2216 River Rad 2 BR 5715 NeWly rmd Utli nb bd Cali 7Q840103)7 RER GROE 8600 W Grand npac 8 2 BD pi 0k ht a/c prkllg $750 and $915 84733g003 ROSEMONT 2010 pt tree ht 8 ckng ga Ci t airprt S Hwy $800 S Up (847)1361699 SKOKE lar 8560 Mile Cnter Rd 5565/m Newly remd nc heat cking g ertg N Pet See Pht f pt al: wwwnlckbuychlcagcm 8416148150 KLE RELTY SKOKE 1t fir 3BR Wd frgd cnti pleae call 2245959146 val May) SKOKE 3ER 26 Optima Cnd 11th flr 2 ndr parking $3OOi Phebe KSGMC 3473312110 SKOKE3BR Luxury 2 lia) apt avail LRDR cabin bit FR w/trpl 2 full B recretian rm S pace tar wainer/ dryer nde prkng cme with thi paciu pt Lecat ed acr frm Old Orchard Calf 8475642300 SKOKE6$Davl lar frani S99Oand 2ER fr $1280 vail Nw 8 May 1 Mdern curtyard buldng Weillandcaped prperty Central air S heat Parking S tuadry Cle t chl S erk Call alantln 7482431140 Thurday pril 30 2009 505 partment Çbnd ijnpumd Suburban SKCKE49 ENFELO 1 BR frm $118$ vat flaw S May t Weilandcaped prperty Heat a waler inciudad Clae l tranprtathn park and hpping Cull Nick 708/1383831 SKOKE421 Cram Lvelylll 28R lrm 5990 vail May t Cle f tranprlcllin Heat Water and parking ncluded Strage S laundry Mut edl T e call aentin 108/2431140 SKOKE: 4937 CHURCH Lrg )Bdrm Central NC heat ndi prkg avail Nai la park cle t Old Orchard Call Barbara 847673)317r Hllmktjhncnlll5456i 60 SKOKE Srmell ti hrdwd fr pplc ht md rdntl area near rn $1050 184154894896 SKOKEn042 N Knxl Deluxe 2 BR apt wfc cb blt newer appic prking launch faclity near lranp park and hpping vli W01/09 5)015 cli Jerry Ettlnger 3126081234 eltinge r M h c 11m a r k hnancam SKOKE 8250c HLES CEN TER RO Lvely 1ER trni $850 vail nw S S) Lrgr mdern kitchen S babil /C trage laundry S parking Heat ndi any (108) 4175891 SKOKE Large 2eR l58 SeparbeR 51095/ma heat inc parking vail Mar) Call Greg 16472746190 SCOKE Le 4rm RR heat ed decr hdwd fr ppi $715850 0414762124 SKOKE Lrgclen2BR 2D Laundry 01W $1000/m 3474734095 506 partment Cnd ijnurnd Chicag USTN/RNG 3 Rm lbr Garden apt 5670/nn md heab laundry avail 8418255406 Package tarting at $500 506 partment COnd Unumd Chicag EDSON PRK pte i bd it S 2nd fir Htd mmed ccupancy 5775 5 $1100 Clark Pcbich RE 7137757653 HGGNS and Nagl 2 br 2nd tir 5850 avail S grdn tudi $150 avail mmed Htd Clark Fablnch RE 7737157653 Lctwrence/Cumberlgnd area lbr cnci willi garage md ga heal H/W fir 5 clet (708)483180 1 LOYOL RE 1 BR STUDOS w/lake view Rent $600/m S up ncid Flat S water Laundry an prem N pet Cali Peter 7733061178 Re Mgmt 8474700071 NORWOOD PRid Hren NW HwY Spcic 1 and 2br DR ak fir heat C pkng pet b $850 and $965 8473388983 52e Garage Parking pace Stre Yur Special Car Hatd ecur MOth r nnuel ll Strage 7736851454 535Hue EDSON PK 4brl2b ranch wd tr tam rm palbelly P bull bitch w/ ail appt C wd deck 2 cr full fin bmb w/d avail 5) 52100 108257430$ GlnvleW rea Centrai 8 Wahingtn cmplete remd Ranch Hme Culdac 3BRF15 B family rm wth/dry lawn maint mcl S180O/nnth Call $473975832 tevenlng) 43e5439225 (daytime) Melrc Park 4BRB bg yard newly remad $1450/ma tenant pay util 8474552849 NORROGE Beautiful Hue 3BR 2B C/C ire yrd fin bmt 2 cr rge (708)2571445 PRK RDGE 4ER 2B tin bmt 1r yard $1950/m Revelt chl $4750e1445 PRK RDGE SBR )SB CC 25 gar nice area 5)850/m (847)8230215 BULDNG HELTHY MERC Natiòna!Nue Week Ôeebrate Natinal Nure"Wèek w1thiñi SunTime NewGrup n May 10 2009 Let lcal Heathcarò Prfeéinal knw abut Nuring and Healthcare pitin available whin yur cmpany by taking advantage f me ecnmical emplyment package d wi!t publih Sunday May 10 2009 in The urra Beacn JUet Herald Naperville Sun Eln Curier LakQ Cunty New Sun The Chicag SunTime The Suthtwn Star PtTribune and Thurday May 7th (n the Pineer Pre Newpaper Circifiatin i ver i 1 millin reader! Pleae cñtact Sandy Glbert at 6309783225 r DavW Fntechia at 63O988567 fr mre nfrmatin! j

B2 Thurday pril 30 2009 535 Hue STREMWOOD $1400/M blutely bcau tiful 3 bedrms i bathrm ranch fr rnt ll nw lnterlr ERY CLEN! Living rm family rm car aarage (driveway targa enugh fr4 car) Fenced bck yard Cle t hpping chl 8 t90 vaitabiejune it Cil Kriten and Steve 6302137837 545 çtdutriaj Cmmercial Office/Warehue/Garage Space Ginview rea 1 300 2000 4000 8 7000 SqF KaZ Mgmt 8416711711 570 Stre Office CHCGO1S1 N Harlem Office 6001200 SqFt OnSite Parking Sme ut!! nc! Bruce 7734914191 ENSTON diacent Stre 609 Ompter S 763 SqFt 611 Dmpter St 911 SqFt @ Chicag ve Rent eparatty r ne 2 packing pace each tre and tul! bmnt 8414757676 LinclrwdSkklN t le i 1454000 SF Tp Ntch Ottic Suite mperial 7737364100 NrthbrkFREE RENT Luxuriu Suite f SO ffice and 30 wrk tatin ha Opac clvatj grat netwrk ng pprtunity dentity prgram al avait cati Sheliy at 847897S789 OHare rca: Rem! De Piam Mt Prpect Schiller Park irprt Pry! 8 Crprate Suite 20030000SF vailable Katz Mgmt 8416111711 wwwohareoiflçerentic Real Elatefr Sale 600 605 artment Bldg at dvertie 24/7 60G Cndmimium Hle Opn Sun i :383:3Opm 6935 Milwaukee ve #107 Lø/neat 28R/2F0 Ely bid mnled p $225000 Prudential Premiar Really 7084361498 615 HuBe Suburban LOU H011i OPPORTUNTY il real etate advertiing in hi newpaper ubiect t the Fair Huing ct which make t illegal t advertie any prfernnc limitatin r dicriminatin baed n age race clr religin ex handicap familial Statu r natinal rigin r intentin t mke any uch preference mitatin r dicriminatin Tite llini Human Right ct prhibit dicriminatin in the aie rental r dvertiing f real etate baed n fac tar in additin t lhe prtected under federa! lw Thi newpaper will flat knwingly accept any dvertiing fr real etate which i n vilalin f the law li peran r hereby infrmed that ail dwelling advertied are available fl an equal p parluniiy bai T cmplain at dicriminatien call HUll lll free at: i 8006699777!thi PLONEERPRESS vu tci uecc The Ding and Pineer Pre Newpaper Chlcae altntin city wrkr t i lluge 4ER Tri level uburban living with Chcag addre Ready fr Update hardwd flr fireplace 5399K call Lu 7057855230 DEE RFELD 74 W Greenbrir Splt level 3 BR 12 B 25 car gar lt ize 80x150 $449000 (847)2917028 Harwd Height 4BR 2B tin b!mt 2Scr gar Sd Schi 2nd kil S299K 7088675227 NORRDGE FrederlCkefl ranch 3BR LR w/termt DR hdwd fir thrughut finihed t$ament flr Nrridge Prk 5339000 (841)4010965 695 Judicial Sale HRW000 HEGHTS N THE CRCUT COURT OF COO< COUNTY LLNOS COUNTY DEPRTMENT CHNCERY DSON CHSE HOME FNNCE LLC Plantlt y JOLNT SURDEL el ai Defendant 00 CH 19050 NOTCE OF SLE PUBLC NOTCE S HERE BY GEN hl puruant t Judgment at Freclure and Sai enlerud in the abve caue Qn December 1 2008 an agent 01 The Judicial Saie Crpratin will at 10:30 M n Muy 28 2009 at the ttic 01 The JudicllScle Crpratin One Suth Wacker Drive 24th Flr CHCGO L 60606 5il at publlr auctien t tite ltlhl hlclder a et frth belw the teliwing decribd real etate: Cantmanly lçnwn a 1011 N OLCOTT ENUE UNT 312 ttarwtl Hegh L 60706 Prperly index N 12 1242300t/005/00W021 P rper v ndex Na 1212425 001/0071003/OOWOO//008 ii N DERNG Prperty ndex N 12il473021 UNDERLY 111G Tix real etate m prved willi a cndminium The udtimaitt amunl wa $31285132 Sale terni: 25% dwn at hip highet bic by ryriitied tund ai lite cle et the aucilit; lte balance tt reriltied tuttcl due W iltltt iweniytuur 1241 hur Tite uhiect prperty i ublccl i getterai rta Oiate lace Cpuciel ament r pecial taxe levied açtalnt ld real ite atitl tlerecl ter ale withut any reprenlglin a t tullty r cluattllty et title and wthut recurc t Plainlilt and n S 1S cndlin Tte al i furltier ublect ta cnfirmatin by the curt f the ie i nef ade fr any rean the Purchaer al the ate hall be enlilled nly t a return f tt depti paid The Purchaer hall llave no further recure againt the Mrtgagr the Mrtgagee r the Mrtgagee attrney Upn payment in full f the amunt bid the purchaer will receive a Crtificte f Saie that will enti le the purchaer t a deed l the real etate after cnflrmalien f the ale The prperly will NOT be pen fr npeclin and plaintiff mke n repreenllin a t the cnditin f the prperty Prpective bdder ar dmanihed fa Check the curt fle t verify ali infrmatin f thi prperty i a cndminium unit the purchaer f the unit at he freclure ale ther than a mrtgagee hall pay the ament Und he legai fe required by The Cndminium Prperty ct 765 LCS 6059(g)(i) and (01(4) F YOU RE THE MORTGGOR HOMEOWN ER) YOU HE THE RGHT TO REMN N POS SESSON FOR 30 DYS F TER ENTRY OF N ORDER OF POSSESSON N C CORDNCE WTH SECTON 151701(C) OP THE LLNOS MORTGGE FORECLO SURE LW Fr nfarmalin cntact Plantiff allrney: The Saie Clerk CODLS 8 SSOCTES PC 15W035 NORTH FRONTGE ROD SUTE 100 BURR RDGE L 60527 (630) 7949876 be ween the hur t i and 3 PM nty and ak fr the aie departmnt Pleae retr tile number 140813746 THE JU DCL SLES CORPOR TON One Suth Wacker Drive 24th Flr Chicag L 60606465e (312) 236SLE NOTE: Puruant l the Fair Debt Cllectin Practice ct yu ar advied that Piaintitfaltrney deemed ta h a debt cllectr attempt ng t cllect a debt at)d any intarmatln btained wll be ued fr that purpe 1171720 Publihed n Pineer Pre 4/30 5/1 5/109 11688281) C HRWOOD HEGHTS N THE CRCUT COURT OF COOK COUNTY LLNOS COUNTY DEPRTMENT CHNCERY DSON JPMORGN CHSE BNK NTONL SSOCTON Planliff LS GBELLN JPMORGN CHSE BNK NTONL SSOCTON Defetidant 00CH38807 NOTCEOFSLE PUBLC NOTCE S HERE BY GEN that puruant i a Judgmenl el Freclure and Sale entered in the abve caue en February 24 2889 n agent et The Juiiclal Sale Crpratin wll at 10:30 M Ott May 27 2009 al lite ttic at Tit Judlcipl Sale Crpratin One Suth Wacker Drve 24th Fleer CHCGO il 60606 ch at public auctien l the highet bdder a el frth bclew the tllwing decribed real tat: Crnmanly knwn a 4542 N OK PRK ENUE Harwd Helgiti L 60706 Prperty ndcx N 13t0iil0300000 Tite reel tat imprved wlh a ingle tamlty reldeitce Thu ludgmttnl amunt wa 53p502174 Sale tertyt: Ttt bld amuni hall be paid n crtltlect tund immediately by tite higitt and bet bidder al the cncluin el the ale Tte ublecl prperty i ubccl le general real etate laxe pcla aetnpttt r pecial laxe levied aealttl ld real etate and tfcred fr ie withut atty repreentalin a t quality r quantly el tlle and wllhul rcure Plaittlltt and in cnditin The al furthor chied le cenlirmalln by lit curt Upen patmenl n lull! lite anteuitt bld ihe purcttaer will receive a Cr ltict t Sal lita will entitc the purchaer l a ticed tite real Oate tter cetitirmallti at lite ale Tt prperly wll NOT be pen tr npectlen ttcl plaltttltt itike n repreentullen a l lite cidiiit cl tite prperly Ptpeclive bdder are ctdmnihed t chck lte curt tile t verily all nlrmailit t lltl prperly a cit(lminium unit tl purchaer t tite unit al tite freclure ale ether lin a merlçlaee hall pay the anietli and lite legal tee required by wwwpineerlcalcm The Cndminium Prperly ct 765 LCS 605(g)(1) and (g)(4)_ F YOU RE THE MORTGGOR (HOMEOWN ER) YOU HE THE RG1T TO REMN N POS SESSON FOR 30 DYS F TER ENTRY OF N ORDER OF POSSESSON N C CORDNCE WTH SECTON 151701(C) OFTHE LLNOS MORTGGE FORECLO SURE LW Fr infrmatin cntact Plaintiff attrney: HENER SCOTT BEYERS 8 M1HLR LLC 111 Eat Main Street Suite 200 DECTUR L 62523 (217) 4221117 THE JUD1 dl SLES CORPOR TON One Suth Wacker Drive 24th Flr Chicag L 806064650 (312) 236SLE NOTE: Puruant t the Fair Debt Cllectin Practice ct yu are advied that Ptaintlffatterny lx dmed t b a debt cllectr attempt ng t cllect a debt and any infrmatin btained will be ued fr that purpe 1177183 Publihed in Pineer Pre 4130 5/7 5/14/139 (1688276) C HRW000 HEGHTS N THE CRCUTCOURT OS COOK COUNTY tllinos COUNTY DEPRTMENT CHNCERY DSON MB FNNCL BNK N Plainliff RLENE Y MONTN el al Defendant 08 CH 41595 NOTCE OF SLE PUBLC NOTCE S HERE BY GEN that puruant l a Judgment f Freclure and Sale entered n the abve cau n pril 1 2009 an agent at The Judicial Sale Crpratin will al 10:30 M n May 7 2009 al the ffice f The Judicial Sale CrpOralln One Suth Wacker Drlve24t1t Flr CHCGO L 60606 el at public uclieti l the highet bidder a t trth belw the tllwing decribed real iate: Crnmanly knwn a 751820 W LWRENCE ENUE Hrwd Heght L 60706 Prperty ndex N 1212424 0780000 The real tat mprved with cmmercial prperly The iudgmnt amunt wa 578710307 Sae lrm: 25% dwn f the ltltjtt Ot bld by crtitid tund al the cle! the auctn; the balance in certltied tund due wilhin twentytur 124) hur The ublect prperly i ublect l general real elale laxo pecial aement r pecial lax levied agle! ld real Otat and ttered fr ale withut any reprenlalleti a t quality r quantity et lill ana withui recure Panllt and in S 15 cttditlen The aie turther ublect le cnfirmlin by he curt Upn paymeni in tull! he Ornean! bld the purchaer will receive a Certiticl el Sle 1h01 will entitle the purchaer a deed t the real 05101e aller cntlrmalln et the ale The prperty will NOT be pen ter npeciln nd plalntltt make n rpreettttln a the cetiditln f the prperty Prpectiv bidder are bdmnltied ta check tte curt flic l verily ali ntrntalln f thi prperly cticlminum Unt tt purchaer f h unit at tt freclure alti ther thatt nieriggee hall pay tit cteniet)t Out lit legal tee required by The Cndmnium Prperly ct 765 LCS 6n5/piu)lll tid (ull) F YOU NS THE MORTGGOR (HOMEOWN ER YOU HE THE RGHT TO REMN N POS SESSON FOR 30 DYS F TER ENTRY OF N ORDER OF POSSESSON N C CORONCE WTH SECTiON 151/011Cl OF THE LLNOS MORTGGE FO4ECLO SURE LW Fr nfrmatin cntact Plaltitilt llrttuy: CHUHK & TECSON PC 30 5 WCKER DRE STE 2650 CHCGO L 65606 (3121 4119300 THE JtJD CL SLES CORPOR TON One Suth Wacker Drive l4ilt Flr Ctticçj L 606064650 13121 236SLE NOTE: Puruant t the Fuir Debt Cllectin Prctciice ct yu are itclviycl lita iaiitilllatit nv cltctncl t be iebt cllecter altemlil ittg te ciled debt ctnd cttty lntrntalln btaltttìd will he ued ter 1h01 purpe 1173686 Publihed in Platiner Pre 4/16 1/23 3l09 11681592) C LNCOLN WOOD N THE CRCUT COURT OF COOK COUNTY LLNOS COUNTY DEPRTMENT CHNCERY DSON US BNK NTONL S SOCTON S TRUSTEE FOR JP MORGN MORT GGE CQUSTON TRUST 2006WMC4 SSET BCKED PSSTHROUGH CERTFCTES SERES 2006WMC4 Plaintiff y RCHRD WLDO el al Defendant 07 CH 2922$ NOTCE OF SLE PUBLC NOTCE S HERE BY GEN that puruant la Judgment f Freclure and Sale entered n the abve cau n February 26 2009 n agent f The Judicial Sl Crpratin will at 10:30 M an May 28 2009 at the ffice f The Judicial Sale Crpratin One Suth Wacker Drive 24th Flr CHCGO L 00606 ell at public uclin l the highet bidder a et frth belw the fllwing decribed real etate: Crnmenly knwn a 6848 NORTH HMLN ENUE LNCOLNWOOD L 60712 Prperly ndex N 1035131 0400000 The real etate i imprved with a ngle family reidence The udgment amunt wa $67127639 Sale term: 25% dwn at the highet bld by certified fund at the cle f the auctn; the balance in certified fund due within twentyfur (24) hur The ublect prperty ublect t general real etate laxe pecal aement r pecial luxe leved againt aid real Otat and ffered fr le withut any repreentatin a t quality r quantity f title and withut recure t Plainllff and in S S cnditin The ale i further ublct l cnfirmalin by the cur! Upn payment n full f theamunt bld he purchaer will receive e Certlllcale et Saie ta will entitle the purchaer a deed t the real etate after cntirmatln f the ate The prperly will NOT be pen tr inpectin and plaintitt make n repreenlalln a the cnditn! the prperly Prpectve bdder are admnlhed l check the cauri file verily ali ntrmatln it thi prperly i a cndettlnium Unit tite purchaer! the unit al lte tereclure al ther thn a rnrluaeee hall pay lite aement and the legal tee required by The Cndminium Prperty ct 765 LCS 605191ll1) and (g)(4 F YOU RE THE MORTGGOR HOMEOWN ER) YOU HE THE RGHT TO REMN N POS SESSON FOR 30 DYS F TER ENTRY OF N ORDER 010 POSSESSON N C CORDNCE WTH SECTON 151701(C) OFTHE LLNOS MORTGGE FORECLO SURE LW Fr lntrtnalin: iit ur webile at h p : \\ e r y c e a t t y piercecm between tit hcur f 3 attd S pm PERCE & SSOCTES Planlilt: llerney One Nrth Dearbrn Street Suite 1300 CHCGO L 60682 Tel N 13121 4765500 Pleae reler la tile number PO/l4907 THE JUDCL SLES CORPO RTON One Suth Wacker Drive 24th Flr Chicag L 606064655 1312) 236SLE 1117221 Publihed lii Pineer Pre 1/35 5/7 5/i4/0i 116902051 C LNCÓLNWOOD N THE CRCUT COURT OF COOK COUNTY LLNOS COUNTY DEPRTMENT CHNCERY DSON THE BNK OF NEW YORK S TRUSTEE FOR TlE CERTFCTE HOLDERS CWLT NC LTERN TE LON TRUST 2006 let MORTGGE PSS THROUGH CERTiFCTES SPRES 205630T1 Plainlitt SHBNM NSR; SYED ZEESN /K/ SYED z L /KJ SYED ZEESHN L NK SYED EESHN Detendcnt 58 Ct 39812 NOTCE OF FORECLOSURE SLE Fher and Sitaplre tile H 00115O lt i advied ltai ntereted prirlle cnult wlit lteir wt ailarney befre bidding cii mrtgage freclure ale) PUBLC NOTCE i hereby given that purunt t O Jdgment f Freclure entered n February 25 2809 Katlen Realty Service nc a Sell ng Official will at 12:30 pm n June 9 2009 at 205 W Randlph Street Suite 1020 Chcag llini ell at public auctin t the highet bldder fr cati a et frth blw the fllwing decribed real prperly: Cmmnly knwn a 3811 Wet Jarvi venue Linclnwad L 60712 Permanent ndex Na: 1026307067 The mrtgaged real etate imprved with a dwelling The prperty will NOT be pen fr npectn The ludement amunt wa $46670794 Sale term: 10% f ucceful bid mmediately at cncluin qf auctn baince by 12:30 pm the next buine day bath by cah 1er check; and n refund The aie hall be ubict te general real etate laxe padal taxe pecial aemnt pecial taxe leved and uperr len if any Tl prperty i ffered a i with n expre r implied warrantie and withut an repreentatin the quai ty f tille r recure t Plainlift Prpectve bidder are admnihed t review the curt file l verfy all nfermallan Fr infrmatin: Sal Clerk Fiher and Shapir 4201 Lake Ck Rd it flr Nrlhbrk lln 60062 (847) 4959990 between i :00 pm and 3:00 pm weekday nly 1170618 Publihed in Pneer Pre O 5/1 5/14/89 11688440) C LN CO LN WOOD N THE CRCUT COURT OF COOK COUNTY LLNOS COUNTY DEPRTMENT CHNCERY DSON FRST SNGS BNK OF HEGEWSCH Plantiff UNKNOWN HERS ND LEGTEES OF SUBRT DS DECESED; KT SHRM NKJ KT PNDE S NDEPEND ENT DMNSTRTOR OF THE ESTTE OF SUBRT DS DECESED; UN KNOWN OWNERS ND NONRECORD CLM NTS Defendant 08 CH 36399 NOTCE OF FORECLOSURE SLE Flttrand Shapir tile # 0010939 i t advied that nlerelect parlie cnult with tlteir awn llrney belere bldditig at marigae freclure ale) PUBLC NOTCE hereby given that puruant la a Judgmnt f Freclure entered en January 35 2009 Kauen Realty Service nc a Sell ng Oltclal will al 12:30 pm n June 2 2009 at 205 W Randlph Street Sulle 1020 Citicag lln ell al publc auctin t he hieltet bldder fr cati a t frth belw lite tllwing decribed real prperly: Cmmnly knwn a 6518 Nrth Kennelit Linclnwd L 60712 Permanenl ndex N: 1034324 026 Ttte mrlgagect real etat imprved with a dwell ng Tite prperly wll NOT be pen fr ttpeclln Ttte ludment amunt cia 542000724 Sale trm: 10% t ucceful bld immediately al cttcluen at auctin balance by 12:35 pn tte next bune day bth by caltiercltck: and n retend Tit ale ttull ftc ublect l gettera ral eme lax pecial laxe pecial asenitinl pecial lax leved and uperr lin f any Tte prperty lfred a whit te expre r niplieci Warrutille ant wilhaul any repreentatin a l lit quality et title r recure Plaintiff Prepeclive bidder are admnilted l review lite curt tile l verliv all inlrmalln Fr nfbrnatin: Sal Clerk Fher attd Shapir 1201 Lake Ck Rd it fleer Nrlitbrek litti 60062 1847) 4909995 betweet 05 pn) and 3:95 nti weekday ettly 1164501 Publihed n Pl;ter Pre (23 1/30 5///09 116859501 C L N COLN WOOD in HE CRCUT COURT OF COOK COUNTY LLNOS COUNTY DEPRTMENT CHNCERY DSON HSBC RNK US NTON L SSOCTON S TRUSTEE UNDER THE POOLNG ND SERCNG GREEMENT DTED S OF UGUST t 2006 Pineer Pre Publicatin (x) FREMONT HOME LON TRUST 2006B Plaintiff MRCE COCN; MR C OCN Defendant 88 CN 28283 NOTCE OF FORECLOSURE SLE Fihrnd Shapir fle#086701 (l i adved that ntereted partie cnult with their wn attrney befre bidding at mrtgage freclure aie) PUBLC NOTCE i hereby given that puruant la a Judgment f Freclure entered n Nvmber 6 2008 Kallen Really Service lnc Slling Offcial will at 12:30 pm en May 29 2009 al 205 W Randlph Street Sulle 1020 Chicag llini ell at public auctin t the highet bldder fr cah a t frth belw the fllwing decribed real prperty: C/K/ 4426 Wet Lunt venue Llnclnwd L 60112 Permanen! ndex Na: 1034109 025 and 1034109026 The mrtgaged real glale i imprved wth a dwellng The prperty will NOT be pen fr npectin The ludgmnt amunt wa $61542899 Sal term: 10% at ucceful bld immedately al cncluin f auctn balance by 12:30 pm the next buine day blh by cahiercheck; and n refund The ale hall be ubiect l general real etate laxe pecial taxe pecial ament pecal lax leved and uperr lien f any The prperty ffered a with n xpre r mpiled warrantie and withut any repreentatn a l the quality f title r recure t Planliff Prpectve biddr are admnihed t rvew the curt fil t verify ali nfrmatn Fr infrmaln: Sal Clerk Fiher and Shapir 4201 Lake Ck Rd it flr Nrlhbrk llin 60062 (547) 4909990 between 1:00 pm and 3:00 pm wekday nly 1175985 Publihed n Pneer Pre 4135 5/7 5/14/89 (1688392) C LN CO LN WOOD N THE CRCUT COURT OF COOK COUNTY LLNOS COUNTY DEPRTMENT CHNCERY DSiON US BNK NTONL S SOCTON S TRUSTEE Painlltf v WLLM 695 Judical Sale RSHO: NMO RSHO; BER STERNS RESDEN TL MORTGGE CORPORTO; UNKNOWN OWNERS ND NON RECORD CLMNTS; Defendant 0e CN 38972 PUBLC NOTCE hereby given that puruant ta a Judgment f Freclure entered in the abve enttled cue n 2f2009 ntercunty Judicial Sale Crpratn will en Wedneday May 27 2009 al the hur f 11 am in their etfice at 120 Wet Madin Street Sulle lt5 Chicag llin ell t the highet bldder fr cah lite fllwng decribed prperty: PN 10 35i 100560000 Cmmnly knwn 7010 N EST PRRE ROD LNCOLNWOOD L 60712 The imprvement n the prperty cnt f a ingl family reidence Sale term: 25% dwn by certf led fund balance wthin 24 hur by certified fund N refund The prperty wll NOT be pen fr inpeclin Upn payment in full f the amunt bld the purchaer will receive a Certifcate et Sale which will enhle the purchaer t a Deed t lt premie after cnfirmatin f the ale Fr infrmatin: it ur weblte al h p : e r y i c e a t t y plercecm Between 3 pm and 5 pm nly Pierce 8 ciale Plainlift ltarney i Nrth Dearbrn Street Chicag lln 60602 TelN (312) 4765500 Retr l Fle Number 0819796 NTERCOUNTY JUDCL SLES CORPORTON Selling Offcer (312) 4441122 1174010 Publihed in Pineer Pre 4116 23 4f30)09 (1684717) C MORTONGROE N THE CRCUTCOURT OP COOK COUNTY LLNOS COUNTY DEPRTMENT CHNCERY DiSON COUNTRYWDE HOME LONS SERCNG LP Panlltf SERLY MTHEW el al Deteneant 05 CH 37811 NOTCE OF SLE PUBLC NOTCE S HERE BY GEN that puruanl t a Judgment el Freclure and HRW000 HEGHTS N THE CRCUT COURTOF COOK COUNTYLLNOS COUNTY DEPRTMENT CHNCERY DSON DEUTSCHE BNK NTONL TRUST COMPNY S TRUSTEE FOR MERCN HOME MORTGGE S SETS TRUST 20MS MORTGGEBCKED PSS THROUGH CERTFCTES SERES 20865 Plaintllf y JOHN NORTHCUTT el al Defendant e CH 33369 NOTCE 01 SLE PUBLC NOTCE S HEREBY GEN that purunl l a Judgment! Freclure cind Sale entered n t abve caue n February i 1 20e9 an client! The Judcial Sale Crpratin will al 10:30 M en May 13 2009 at the ffice f Tite Judicial Sale Carperailn One Suth Wacker Drive 24th Flr CH CGO L 60606 eil al publc auclin t the hlghel bidder a el trt belw h fllwing decribed real etate: Cmmnly knwn a 4318 N NEWCSTLE ENUE tiarwued Height L 60706 Prperly ndex N 1310306033 The real clate imprved wilt a ingle ttally reidence The udumcnt amuni wa $40784617 Sie terni: 25% dwn f tite tticjlicl bld by certitied land al tite cle al tte auctin; ihe balctnce n certified fund i due within twentyfur 124) heur Tte ubiecl prperly i uhiecl l penera real etat lue pecial enienl rnpecial taxe levied againt ad real etate and i altered ter ale wltitul any repreentatin ct l quality r tuatility et liti and wthut recure te Plainllt and n ls cnditn The ale turnier ubjeci le cnfirmatin by h curt t lte ale i el aide fr any rean lite Purchaer at lite l hah be entitled nly l g relurn f le depil pad The Purcltaer hall have n furliter recure aainl the Mrlaagar tte Mrtgagee r the Merl(lçleeallrny Upn paymett in full t tite amunt bld the purchaer will receive a Cerlitical f Sle hal till culill lt purchaer a deed l lt rt elate tter cntlrmahin f the ale Tit prpcrtywll NOT be pen ter itipclln and plalntllf make n reprenlatln ct ta lite cetidihin f le prperlv Prepective bidder are udrttnllied t ctteck the curt tile l verty l ttlrniatien f titi prperly i a cltdmittium util the purchaer f le uttit al the brdure aie aliter litait a muriguje hall pay le aecniettt anti the lel fee required by The Cndminium Prperty ct 765 LCS 605/Ylul l i and lit 14) i F YOU RE THE MOR1GGOR HOMEOWNER YOU HE THE RGHT TO REMN N POSSESSON FOR 30 DYS FTER ENTRY OF N ORDER OF POSSES SON N CCORDNCE W] l SEC1 ON 1517011Cl OF THE LLNOS MORTGGE FORECLOSURE LW Fr ntrmlitt cnhtici Plalnitltctllry Tte Sal Clerk CODLS O SSOCTES P0 15W030 NORTH FRONT GE ROD SUTE 100 BURR RDGE L 60527; f630) 7949076 between th"iteur! 1 ticl 3 PM nly and tii fer lity aie clepctrlmnl Ple retr t tle nutnber 1408 237/4 THE JUDCL SLES CORPORTON Ott Suth Wacker Drive 241it Flr Chictte L 606064650 13121 36SLE NOTE: Puruant i lte Fair Debt Cllectien Practice ct yu re advied 1h01 Plaintiff atlrny leenteci be a debt cllectr altenpiln t cliec a debl and any littricthltt binined will be ued O ba purpe 1114452 Publlttd n Pineer Pre 4/16 4/23 4/30/09 (1684588) C j\ pineer Pre Publicatin (Dc) 695 JudiCial Sale : Our utmtive Sectin ha the Car yu are king fr Buying r : Seling Pineer Claified i theplace fr yu! (847) 9983400 Our Àtive Sectión ha the Cçryu are lking fr Buying r Selling Pineer Claified i the place fr yu! (847) 9983400 MORTON GROE N i HE CRCUT COURT OF COOK COUNTY1LLNOS COUNTY OEPRTMENTCHN DSON DEUTSCHE BNK NTONL TRUST COMPNY S TRUSTEE UNDER THE POOLNG ND SERCNG GREEMENT RELTNG TO MPC SECURED S SETS CORP MORTGGE PSSTHROUGH CERTF CTES SERES 20064 Plantiff LORENN llorn NR/ LOREDN N BORN NK/ LOREDN BORN el al Defendant 07 CH 34726 NOTCE OF SLE PUBLC NOTCE S HEREBY GEN that puruant i a ;udjriett et Freclure and Saie entered in le abve laue it March 17 2009 an agent b The Judicial Sale Criiralien will at 10:30 M an May 26 2059 al lit attica 01 lte Judicial Sale Crpratin Ott Suth Wacker Driv 211h Flr CHCGO L 60606 l at public aucdti le the itighel bidder a et frth belw the fllwng tit cle al ba auctin; he balance in certifed fund S decribed real elal: Cmmnly knwn a 7736 DS du wilhin twentyfur (24) hur The ublect prperty STREET Mrtn Grve L 60053 Prperly ndex N 09 13307521 The real etala i mprved with O ingle famly reldetce The ludgmenl amunt Wa $43224489 Sal terni: 25% dwn at tte hghet bld by certified fund al ublci l general real etate taxe pecial emefll r pecial lax levied agant aid real etale and i fbred fr ale withut any repreenhalln 05 lo qualily r iluanhily a! lile and wthut recure l Plaintiff and n S 1S cndilln The ale further ubict 10 cnf rmalieti by lt curt t the ale el aide fr any rean flic Purchaer al he l hall be enttled nly t O relurn cl ; depil pad The Purchaer hall beve na furliter recure agant le Merteagr le Mrtgagee r the MrjageeSatlrney Upn payment in full f the amunt bid the purchaer will receive a Certficate f Sale lita ttil entitle ba purchaer l a deed t the real etate after centirmatin f the ale The prperly will NOT be pen lar inpectn and plaintiff mk n repreentatin 05 lo lite cnditn f the prperty prpective bidder are adtttxniltd check the curt fili l verify ali nfrmatin lt ibi prperly i a cndminium unii he purchaer f lit uttil at the freclure al aliter ban a mrtgagee hall pay le aemnhs and the legal fe required by Tite Cndminum Prperty d 765 LCS 605191g) 11) and 111141 F YOU RE THE MORTGGOR (HOME0W ER YOU HE THE RGHT TO REMN N pqsses SON FOR 30 DYS FTER ENTRY OF N ORDER OF POSSESSON N CCORDNCE WTH SECTON 15 11011Cl OF THE LLNOS MORTGGE FORECLO SURE LW Fer nfrmailen canlctct plalfllltfs utterlev lte Sal Clerk CODLS & SSOCtTES PC WOJO NORTH FRONTGE ROD SUTE 100 BURR RDGE L 60527 (630) 7949076 blwen lit hur! 1 iii;l J PM nly uttd ak fr lite ale deparintnt Pleae relit i tile itumber 14e7P6lU THE JUDCL SLES LORORTiON Ott Sulli Wacker Drive 24111 FlOr Citi (nit L 606064650 (312) 236SLE NOTE: peruanl t tit Fuir Debt Cllectin Practce ct eo are advied lta Plnitttltfaltarney deemed O be a debt clleclr cilteittpling la ciled a dbl and any lnfrmahlan btained will be ued tar tt! purpe 1177155 ublltted in Pineer Pre 4/30 5(7 5(14/09 (16882731 C Sal enbred n lit abve cue it March 25 2009 an agent ai The Judicial Sle Crperahln will al 10:30 M en May 26 2009 al lite tlice et The Judcal Sale Carperallan One Suth Wacker Drlve241h Flr CHCGO L 60606 ell at public auctan l the highet bidder a t rlh belw the fllwing decrbed real ate: Crn manly Knwn 05 8032 MNSFELD ENUE Mrtn Grve L 60053 Prepcr19 ndex N 1017426019 Prperly ndex Ne 1O17426 020 The real elle imprved wlh a ingle tamily redence The ludymnt amunt wa $44455582 Sl term: 25% dwn f the hghet bid by certifed tnd at the cle el the auchlett; le balance in cerlilled fund due wilhn twnlyteur 1241 hur The ubiedt prprtv i ublect O general real etate taxe pecial aesmenl r pecal laxe levied againt aid real etate and ffered ter le withut any repreetilailn t quality r qanilly al lilie and withu recure l Plaintilt and n S 1S cndtn The ie i further ubiect la cenhirmlin by tite cauri f the ale el ade fer any rean the Purchaer al the ale hall be enhilled nly a return f the depit paid The Purchaer hall hve n furlher rcure aginl the Merlga gr ba Marlggee r tie Murle0000 allrny Upn payment n full! le ameuni bld the purchaer wll recebe a Certificat at Sle that will enhile the purchaer a deed t the real etala alher cantirmalln! the ale The prperly wll NOT be pen fer npectin and plainlift make n repreettlation a l the cnditin et the preperlt Prpechiv bidder are admnhed check h curt file l verity all ntermallan f bi paperly i candntlnium unt the purchaer h the unii ai the freclure ale ether ban a mrtgagee hall pay the aesmenls and the legal tee required by The Cndminum Prperly ct 765 LCS 60S/Ylg)11) and (g)l41 F YOU RE THE MORTG GOR (HOMEOWNER) YOU HE THE RGHT TO RE MN N POSSESSON FOR 30 DYS FTER ENTRY OF N ORDER OF POSSES SGN N CCORDNCE WTH SECTON 1517011Cl OF THE LLNOS MORT GGE FORECLOSURE LW Far lnlrmllao cntact Plalntill allerney Te Sale Clerk CODLS 8 SSO CTES PC 1SW530 NORTH FRONTGE RODS SUTE 100 BURR RDGE L 60521 (6301 7949576 between the heur f 1 attd 3 PM nly and ak fr hn ale deparimenl Pleae rter t tile number 140026126 THE JU DCL SLES CORPOR T1ON One Suth wc¼er Drive 24th Flr Chicag L 606064655 (312) 236SLE NOTE: puruant l the Fair Debt Cllectin Practice ch yu are advied hal plalnlltlallernev i deemed l be a debl cllectr 0110mPh ng O cllect a debt and any intrmailn btained will b ued fer lta purpe 1116283 publihed itt Pineer Pre 4/30 5/7 5fln53B9) MORTON GROE N THE CRCUT COURT OF COOK COUNTY LLNOS COUNTY DEPRTMENT CHNCERY DSON US BNK N Pllnll! EDDRCHRD MKSR el ai DetendOnt 55 CH 33378 NOTCE OF SLE PUBLC NOTCE S HERE BY GEN 1h01 puruottt la Juctgmenh! Freclure and Sale ettlered n the abve caue n February 20 2009 an agent f Tte Judicial Sie CrPrOlin will cit 18:30 M n May 22 2009 at he ttic 01 The Judicial 5ct10S Crp ratin Ott 5ct11 Wacker Drive 2411t Fleer ChCGO L 60606 el h public tuclin O le iigliesi bl;dr et brut belw tite leilewinfi decribed reel cilu" Cenintnly towtt a 6166 WSHNGTON COURT UNT #234 Merlati Greve L 60053 PrperlY ndex N 10 203OS017fl01 prperty litdcx N 1l020121822 021 e211020 UNDERLYNG) Tit wwwpineerlcalcm 695 Judcial Sale ltidleial Sale «real ate mprved wlh a cndmnum Tti iudtltnent amunt wa $36401222 Sle lerm: 25% dwn f tte hgh bid by cerlitied fund ah lite d at le aucllnt le balance n certilled fund due wlhin wenlyfur 1241 hur The ublect prperly ublect l general real etal taxe pecal aement r pecial taxe leved agant ld real efle and altered fr ale withut any repreenlallon a la quality r quantity f tille and wehut recure t Plainlill and in S l5 cnditn TtO ale i furthr ublect cnfirmatien by hte curl if lte ale el aide far any re000n the Purchaer at the ale hall be entihled nly t a reitirn f the dpib hld The Purchaer hall have n furlher recure againt he Mrhgager he Mrtgagee r the Mrtgagee attrney Upn paymenl n full f lte arnaunh bid hn purchaer wll rcelve Cerhiticat at Sale hal will entille tt purchaer l a deed O h real lete atter cenbirmallan f the ale The prperly will NOT be pen fr npectin and plainlitt make n repreentatn a l the cnditin at the prperly Prpectiv bdder ar admnhed le chck le curt fil verify all infermahlen lt thi prperly i a cndminium unit the purchaer f lte unt al the freclure ale albr hn a mrtgagee halt pay the aemnl and he legal fe required by The Cndmn um Prperty ct 765 1LCS 605/910)11) and (g)(4) F YOU RE THE MORTG GOR (HOMEOWNER) YOU HE THE RGHT O RE MN N POSSESSON FOR 30 DYS FTER ENTRY OF N ORDER OF POSSES SON N CCORDNCE WTH SECTON 151701(C) OF THE LLNOS MORT GGE FORECLOSURE LW Fr inlrmlln cnlch Plainhltf ltrney: The Sale Clerk CODLS 8 SSO CTES PC i5w030 NORTH FRONTGE ROD SUTE 100 BURR RDGES L 611537 (630) 7949876 betw000 he hur et 1 and 3 PM nly and ak tar the ale de partment Pleae retr tile nutibor 145821852 THE JU DCL SLES CRpR TON One Suhh Wacker Drive 341h Fleer Chicag L 606064658 1312) 236SLE NOTE: Puruant tie Fair Deb Clldn Prachlce ct YOU ar advied lta pualilt50ll0rn0 i5 deemed be O debt cllectr atlempl ng O cllect a debt and any lntermtln btaned will be ued lar 1h01 purpe 1176298 Publhed t pineer Prn O 511 5/lt09 (1688307) C MORTON GROE N THE CRCUT COURT OF COOK COUNTY LLNOS COUNTY DEPRTMENT CHNCERY DSON DEUTSCHE BNK NTON L TRUST COMPNY S TRUSTEE FOR HB 28077 plalnlf y SMON ST1RBUetal Defendnt ebch2sst2 NOTCE DF SLE PUBLC NOTCE S HERE BY GEN that puruani t Judmenl f Freclure attd Sale nlerd n the aby caue On February 19 2009 an agent f Ttte Judcal Sale crpratin will al 10:30 M n May 21 2009 h le ttic f TtO Judicial Sate Carpratin One Seulh Wacker Drive 24th Fleer CHCGO L 60656 l at public auclin O lt highet bidder 05 el tril belw lite fllwlttg decribed real tat: Crnmanly knwn 05 591t N M SON E Merlan Grve L 60053 prperly ndex Na 10 17416031 PrPerly ndex N lo114160fl The real e hale S mprved will a ngl hmily reidence Tte ludgmen atitunt wa S876171O Sale erttt 25% clwn at lite titiltesh bid by crlitted tutid ai lite clse f tite ucliotti hite halattcc itt certified tuttd due willtitt lwntyfeur (241 taur TtO ublecl prttrly ubich i etterctl real etaio laxe Pecial uenteiti r pecial laxe levied cuainl ld real hl aitd thered ter al wltoul env reprettthtt a la quality er quanlilv at fille tid willut recure he planllf attd it S 1S cetidillht Tie ale 5further ublct t cantirma admnihed t checlelhe Slreeh Sulle 1300 lin by tite curt f the kale i curt file l verify all nfer CHCGO L 60602 T N et aide fr any rean the mallen f bi prperty a (312) 4765500 Pleae rater la Purchaer at 111e ale hall be cndmnum Unt the pr flic number P0517086 THE entitled nly t a return f the chaer at the unit ut the fr JUDCL SLES CORPOdepit pad The purchaer dare le iter ttan RTON One Sufh Wacker hall te n turlher re OrtgageO Çili pay the Drive24th Flr Chicag L cure againt the Mriga emenl and the legal tee 656064650 (312) 236SLE tier the Mrtgagee er tte requred by The Cndmni 1178111 rlgageeo atlrny Upn urti Prperty ct 765 LCS Publlhdlfl Pineer Pre payment in full! the amunt 605l(g)(i) and (g)(4) F hflhls!75/14/09 (1658412) C bld the purchaer wll re YOU RE THE MORTG celve a Certfcate f Sale GOR (HOMEOWNER1 YOU ta will enttle the purchaer HE THE RGHT TO REt a deed l the real etate f MN N POSSESSON FOR ter cntirmalln et the ale 30 DYS FTER ENTRY OF Th prperty wll NOT bó N ORbER OF POSSES pen fr inpechin and plan SON N CCORDNCE 11ff make n rpreonttlen WTH SECTON t5171 (C) a h hecndltinn f the prp OF THE LLNOS MORTerty RrOPeChl60 bidder are GGE FORECLOSURE admnihed t check the LW Fr nfrmatn doficurt fle t verify all nfr tact plaintiff attrney: The mallen f bi prperly i a Sai Clerk CODLS 8 SSOcndmnium unt the pur dtes P0 15W030 chaer f h unit at the tre NORTH FRONTÓE ROD clure al lier than a SUTE 100 BURR RDGE merlgaftee hall pay the a L 60527 (630) 7949876 beemenl and h legal tee tween the heur f 1 and 3 PM requred by The Cndminl nly and ak far the le deum PrpertY ct 765 LCS parlmenf Pleae refer fil g5/9(g)(1) and (g)14t F number 140819646 THE JU YOU RE THE MORTG DCL SLES CORPOR GOR (HOMEOWNER) YOU TON One Sth Wacker HE THE RGHT TO RE L MN N POSSESSON FOR 606064650 (312) 236SLE 38 DYS FTER ENTRY OF NOTE: Puruant t the Fair N ORDER OF POSSES Debt Clldin prctice SON N CCORDNCE ct OU are dvld that WTH SECTON 1517011Cl plalntlffallarnev deemed OF THE LLNOS MORT ta be a debt cllectr atbmp GGE FORECLOSURE ng t ciled a debh and any LW Fr nfrmatn cn ntrmallan btained will be tac Plalnllff ahlrfley The ued fr tha purpe Sale Clerk CODLS 8 SSO 1177542 CTES1 PC 15W030 Publihed in Pineer Pre NORTH FRONTGE ROD SUTE 100 BURR RDGE L 60521 (630) 7949876 be MORTON GROE ween the hur f 1 and 3 PM N THE CRCUT COURT nly and ak fr ba le de OF COOK COUNTY parlmenl Pleae rter file LLNOS number 146019939 THE JU COUNTY DEPRTMENT DCL SLES CORPOR CHNCERY DSON TON One Seulh Wacker WELLS FRGO BNK N Drive 2411 Fleer Chcag L Plaintiff CONNE DOLL 606064650 (312) 536SLE NK/ CONNE M DOLL el NOTE: Puruant t nc Fair al Defendant Debt Cllectin Practice 55 CH 27345 d yu are advied that NOTCE OF SLE panitf5ott0r00y i dmed PUBLC NOTCE S HEREl be O debt clleclor attempt BY GEN tha puruant ha a ng l cllect a debh and any Judgment f Freclure and nfrmahln btained will be Sle entered in the abve ued lar that purpe cau an Nvember 26 2005 1176085 an agent at The JudC101 Sale publihed n Pineer Pre Crparahln will at 10:30 M 4r23 30 5/7/09 (1686279) C June 1 2009 al the ffce f The Judicial Sale Carpe MORTON GROE rallen One Suth Wacker N THE CRCUT COURT Drive 241h Flr CHCGO OF COOK COUNTY L 60606 ell at publc auc LLNOS lin the hlgitet bdder a COUNTY DEPRTMENT el frth belw the bellwing CNCERY DSON decribed real etate: Crn CHSE HOME FNNCE manly knwn a 5007 LLC Pctnhill MGUEL CHURCH STREET MRTlNEZ0b0dbdhtd0utl MORTON GROE L 60053 OSCH 30557 prperly ndex N 1017403 NOTCE OF SLE 007 1017403508 The real e PUBLC NOTCE S HERE bate mprved with a ngle BY GEN that puruant O O family reidence The lud Judgment at Freclure and men arnaunl wa 514938038 Sale enlered n le abve Sale lerm: 2S dawn f the cue n February 24 2009 highet bld by certified fund an agnl! Thi Judical Saln al tche5o f thu auctn; the Crpratin will at 10:30 M balance n cerlitled tundo n My 27 2059 al lite ttic due willtitt wetilyteur (24) h The Judicial Sle Carp heur T ublecl prperly rallen One Sult Wacker ubiedt l general real elale Drive 24111 Flr CHCGO laxe pecial aetiten L 606116 yhl al publc auc r pecal laxe levied liait t lte higite! bidder againi aid real elhe and el lerlil belw lie fllwing altered fr le wilul tty decribed real etala: Camreprntallen a qualihy mnly knwn a 5701 MN r quantity al title and with STREET MOrOn Grve L ut recure l plaintiff and 60053 Prperly ndex N 10 n S 1S cnditin The ale 2e403039 TtO real elal furthrubldt l cnfirmprved wth a ingle family tian by the curt Upn ROYreidence The ludemenl ment n full f the amunb bld amnl wa $30036431 Sle the purchaer will receive a term: 25% dwn f h hgh Crhifict el Saie that will t bid by certfied fund at enhle the purchaer h O the cle f nc auctin; h deed t the real etate iler balance t certfied fund canflrmhln! the ale The due withitt wlyfaur (241 piaperty will NOT be pn fr heur The ublect prperty i npectin and plainlitt ubledt O general real etate niae na repreeabbln a laxe pecial aelnenl the cndtn f the prperty r pecal lax levied prpectiv bdder are adagant ad real tale and manilted O check the cauri altered tr ai witheuf any tile f verfy all intarrnlifl rpreenlahln a t qulily f 1h15 prperty a cndor quanlily f till and wth mnum uni the prchaer f euh recure t pllnliff and the unit al ng brecljur n 15 cnditn The le le alher than a mrtgagee further ubld! t cnfirmahall POY the aement lin by inc curl i lta aie and the legal fee required by al ade fr aay rean le The Cndrnifliuni Prperty Purchaer al the le hall be /5cl 765 LCS 605/9(9) ii) and enlilled nly ta O return f the (g)(4l F YOU RE THE dpall paid The Purchaer MORTGGOR (HOMEOWN hall llave n furiltr re ER YOU HE THE cure gainl the Mrva RCT TO REMN N POS ear lite Mergacle r lb SESSON ror 30 DYS P Mertu000e allrny Upn TERENTRY OF N ORDER pityntetil n ttilof tberflount OF POSSESSON N Cbkt le purchaer wll re CORDNCE WTH SECtON celve a Cerllicl et Sl 151101(C) OF THE LLNOS litai will ettlille lte purchaer MORTGGE FORSCLO O deed la the real elale ab SURE LW Fr inlrnia 1er cnhlrtltlln f hit alo tien: al ur wbile at Tte prperty will NOT be ht P e \Se rvc e alt Y ann fr npedhotl and plain plrcecm belween lt lilt niae n rpreenlahln br al 3 and 5 en PERCE a tite cttdlbin t tte prei a SSOCTES Plalntifll rty PrPectiv bidder re flritay One Nrth Drlwlhe filwing decribed ri prepel CarnmOhlY Thurday pril 3O 2009 695 Judical Sa103 " ; 695 Judicial Sle i 695 Judicial Saje ; f ucceful bid immedatet al cncluin f auctin balknwn OS 9024 MarmrU venue MrlOb Grav L 60053 Permanflf ndex H: 1017 409eSO The mrtgaged rt ilte l mprved wlh a dwellng The prperty will NOT be epen fr npectin The ludement amunt Wa $21897651 Sale term: 10% NSEOK SUN; WOODLNDS warrantie and withut any MORTON GROE ance by 12:30 pm the nitet MORTON GROE CONrPrP505fatl00a5t0th0fl0 NTHECRCUTCOURT bune day blli by cah NKJ SOON J SUN; with na expre r implied OF COOK COUNTY br chckl and na refund 100M NUM SSOCTON; t f title r recure t Plan LLNOS The le hall be ubleci O UNKNOWN OWNERS ND tff Prpectv biddr re COUNTY DEPRTMENT general real etala laxe pe CHNCERY DSON dal taxe pecial ae JPMORGN CHSE BNK mon pecial lax levied NTONL SSOCTON and uperr lien f any Plaintllt SOONJ SU4 The prperty altered 05 i NONREC0RD CLM admnshed ta review the NTS Defendant curt file t verify ail nfr 05CH41519 mtin Fr infarmallofl NOTCEOF Sale Clerk Fiher and FORECLOSURE SLE Shapir 4201 Lake COOkRd CONDOMNUM it flr Nrthbraek llni Fihernd Shapir 60062 (847) 4959990 between fil # 0813147 :00 pm and 3:80 pm week (l adved thai ntereted day nly 1178053 parlie cnult with ther wn Publhed n pneer pre Randlph Stref Suite 102e BNK OF NEW YORK S ftarney befre bddng at n June 9 2009 al 205 W CHNCERY DSON n:rtilalle freclure ale ) 4130 Wi 5/14/09 (1685445) C PUBLC NOTCE hereby given tha puruant l a Jude MORTON GROE ment f Freclure nlerd NTHECRCUTC0URT n FebruarY ii 2809 Kahlen OF COOK COUNTY R0OY SNid nca5 Sll LLNOS ng Offical will al 12:30 pm COUNTY DEPRTMENT Chcag llini ell at pub TRUSTEE FOR THE CERlic aucton l the highet bld TFCTE HOLDERS der fr cah el frth be CWMBS NC CHL MORTlw the fllwing decribed GGE PSSTHROUGH real prperty: Cmmnly TRUST 2006HYB MORTknwn 05 8300 Calle venue GGE PSSTHROUGH Unit F305 Mrtn Grav L CERTFCTES SERES 60053 Permanent ndex Ne : 2006HYB1 Plaintlib fee required by 765 LCS ll advied tha inlereld 1020i2121243 (1020121 DOUGLS BB; MORTbuine day blh by cah en February 25 2089 KailOn 031 and 1020301Ele Underly GGE EL ECTRONC REG ng PnS) The mrtgaged real 5TRTON SYSTEMS lale i mprved wlh a NC Defendant dwellng The prperty will OB CH 38979 NOT be pen tr npdlon NOTCE OF The purchaer f nc unt alb FORECLOSURE SLE er than m0rtgalteo hall PaY Fiher and Shapir the aement and the legal tle 0810943 605/9(0) (1) and (g) (4) Tt partie cnult with their wn ludemnt umufll wa ahlarney befre bidding! 525983005 e term: 10% mrhag freclure ale1 f ucceful bld mmediately PUBLC NOTCE hereby al cttclulefl f auctn bl given 1h01 puruant la Judg nce by 12:30 pm th next rnnl f Freclure entered tr chck; and n refund Realty Service nc 05 Sli The ale halt be ubiect O ng Olficll will at 12:35 Pm general real hlo taxe pe an May 27 2009 a 285 W admnihed t review the 0913359021 Te mrtgaged curt tle l verfy all mar real eptle i mprved will a dl lax pecial 055055 RandOlph Street Sull 1020 mn pecal laxe leved Chicag llini ell al pubmullan Fr lttfrmhlen dwelling The prperly will and uperir len f any lic auctn l tit highet bld The prperly altered 0S l der tr cah a l farlh be SaO Clerk Fhier nd NOT be epeit fr npctiti wilh n expre r implied lw the fllwing decrbed warranlie nd wllhaul any real prperly: Cmmnly repreentahln a t tt quali knwn a 7906 Wet Lake lv f llie er recure te Plain Sred Mrtn Grave L tiff prpective bdder re 60053 Perm0000l ndex N: Shapir 4201 Lake Ck Rd The udgntenl atitutil wa it flr Narhitbrek llini $369250 41 Sale leruti: 1% 60063 (8471 4980990 between f ucceful bid ltnrnediatly 1 :00 pm and 3:00 prit week al cncluin cl auctin beldaynly nce by 12:30 pm tte na 1165735 bune day bth b cat Publihed n Pineer pre lr check; and n retnd ty f tlle r recure t Plain 30 5/7 W1W9 (16118453) C The ale hall be ublecl O tff Prpectiv bdder re general real etate laxe SPa :ud tile verity il n rcgl laxe pecial aeadmnihed t review the menb pecal la leved and uperir len any The prperty flered 5 with n expre r implied warrantie and wthut any rpreentablan a f the quailmallan Far nfrnalin Sale Clrk Fher and Shapir 4201 Lake Ck Rd 15f flr Nrthbrak llin 60062 (84» 4959990 between i :00 Pm and 3:00 pm week day nly 1170665 Publihed n Pineer Pre 16 4E3 3W09±74)C MORTON GROE N THE CRCUT COURT OF COOK COUNTY LLNOS COUNTY DEPRTMENT CHNCERY DSON DEUTSCHE BNK NTON L TRUST COMPNY S TRUSTEE FOR THE BENE FT OF HRBOREW 2005 4 TRUST FUND Plantiff JCKE K CL NR/ JCKE CL NR/ JCQUELNE K CL; MORTGGE ELECTRONC REGSTRTON SYSTEMS NC S NOMNEE FOR COUNTRYWDE HOME LONS NC; N CL UNKNOWN OWN ERS ND NON RECORD CLMNTS DefendOnl MORTON GROE 08CH12713 NTHECRCUTCOURT NOTCE OF OF COOK COUNTY FORECLOSURESLE LLNOS Fiher attd Shapir COUNTY DEPR TMENT file 485003021 CHNCERY DSON lit advied lita niereld JPMORGN CHSE BNK partie cnult with lucir OWn NTONL SSOCi ON hlrttey bter biddittu nl Plittliff BDUL S ntrlgjc freclure ale RN NR/ SOUL PUBLC NOTCE ttercby RN; OMEKULSOOM glvtt lta pumutlttt l a Jude RNt FRSt MERCN ntn! FarclUt nlerd SNKt lremer BNk it March 10 2509 Kauen Re JPMORGN CHSE BNK ally Service nc a Sllittu NTONL SSOCTON Official will at 12:30 pit n UNKNOWN OWNERS ND June 11 2009 al 2115 W NONRECORD CLM Rattdiph Street Sll 1020 NTS OfndOnt Chcag llini ll al pub 08 CH 38123 lc auctin la ba hiuhei bld NOTCE OF der ter cai a l trlh be FORECLOSURE SLE 695 Jud(ciaSaS»" 695 Judical Sle Cl (84/i 9981400 Emuli ciaitied@ pinrlccicm Online tit!p:\rder pinericczlcm Fax (847) 4867497 PONEER PRESS POR OÇ 5(t)KCt t1îr iiin 695 Judical Sate 695 Judcial Sale 695 Judcial Sale 695 Judicial Sale 695 Judical Sale

B Thurday pril 30 2009 wwwpineerlcalem Pineer Pre Publieatin (irc) 555 Jdirei Sl 695Jdril Sle S75JudrtSe 655 JdreiSie 655JdS SOSr 555J155r17 Slc C95Jdr SOeS 895JtSdiOl S Sc ß95JdOl S 555 Jd(c9l wwwpineerlcal00m SOS Jdlirl 5006 dayp30 ß9DJ4di061 56g5Jdi5DSS55 Our utmtive Sectin ha the Our utmtive Sedn ha the Caryuare Caryuare a cking fr lking fr Buying r Buying r Seihag Selhng 2222 a " : e r 2 c O i " a Pineer Pineer Claified Claified " 0 i the place i the place fry& fryul 998 3400 9983400 4 0 r w 2 50 r r S w O r 0" r 2 " 0 2 585 tr 405 r 10 r r 0ilCil0d LLNOS CLSS toymeñt SERCES rn 555SS5 ü5 55eeS0Y u e H 8 0 5!fl555050 zr ;0urr annuureeuuass 5" cua OERTSNG NETWORK eee St 505 kr C k S ONWLT8O e 0G DOE "icellneo5js 0 ELESTTE 585110 5frlFltS FNNCPSJ cn a BUSNESS c 05 Sç C5w ON CL puted r DRERS 0 k er" re OS rrr 5 eeres9 " C5 5COUWY S5Ol5 " ara aaii NSCEL_0500S 800 r5515050tcndnflhsp pfl5tosno 5554764069 k MNO POOLS c000srsç55 r0o PORSE «p05: 55O544 DStE CtSr 7nEc0N3UUX" ne 515 &t5 500SO 03155001000YU : 454 e S 00 ce 82ic2niiei5055 15 2 12?50 if9 2i54 22 a 515 ie 0Ja52 22 an 00 O0 cdrsporste a: CESO 0155 LS t ce lcr 5500 "4 SS C UE CRS t r 5 rs 0 a5 re Cr S 55 51 rc:o Cli ib55406*" S*510751JD*4St "C10N Cr laa"" PROPERTES SSS ewrcriliitc"s StlC55 0S± SS 54! O naur:0 c750s4 COrOS 4ca 115 0) 044 Te ails SerS Sdv5055 5010055 (05141 p0500 P0P5050 aal Th4 SSnO 005 4405 015 rases 0(7 7050 pse 05 C ls drectif 01 Sll 54 1 ts crmrorsos 55 SSU encre5 qoslae Oa 55 peer PDee OflS 5150

B J Thurday pril 30 2009 695rn Judicial Sale THE BNK OF NW tor( S TRUSTEE FOR THE BENEFT OF CWMBS NC CHL MORTGGE PSS THROUGH TRUST 200121 MORTGGE PSS THROUGH CERTFCTES SERES 200721 Plantiff v NCUT MUTUL; LL NCE FRE PROTECTON NC; UNKNOWN HERS ND LEGTEES OF NCUT MUTUL F NY; UNKNOWN OWNERS ND NON RECORD CLM NTS; Deendan 08 CH 37142 NOTCE OF SLE PUBLC NOTCE S HERE BY GEN that puruant t a Judgment f Freclure and Sle enlered n the abve nllfled cue n February 24 2009 ntercunty Judicial Sala Crpralin will n Wedneday May 27 2009 at the hurt J rn in their ffic at 120 Wet Madin Street Sute lis Chlcaçi llini ll 01 public auctn t the highet bidder fr cah et frth belw the fllwng decribed mrigaged real ate: PN 1021lldOfl rid 030 Cmmnly knwn 5332 Greenlet Street Skkle L 60077 The mri000ed real etale imprved with a ingie fmily reidence Saie term: 10% dwn by certified fund balance by certified fund within 24 hur N refund The prperty will NOT be pen tr inpectin Fr nfrmalin call the Sie Clerk at Plainfiff ffrney The Wirbicki Law Grup 33 Wet Mnre Street Chicag llini 60603 (312) 3609455 W080675 intercounty JUDCL SLES CORPORTON SellingOfficer (312) 4441122 1174094 Publihed in Pineer Pre 4116 4123 4P3W09 (1684707) C S KO K le N THE CRCUT COURT OF COOK COUNTY LLNOS COUNTY DEPRTMENT CHNCERY DiSON US BNK NTONL S SOCTON S TRUSTEE UNDER POOLNG ND SERCNG GREEMENT DTED S OF UGUST 1 2006 MSTR SSET BCKED SECURTES TRUST200 fte3 MORTGGE PSSTHROUGH CERTF CTES SERES 2006HE3 Piaintiff v MKEL YOUNN SHRON OUNN Defendant 08 CH 39160 NOTCE OP SLE PUBLC NOTCE S HERE BY GEN that puruant t Judgmenl f Freclure and Saieritered in the abve entitied caue n January 26 2009 nlercunty Judicial Saie Crpratin will n Mnday lun 1 2009 cil h hur f 11 am in their ffice al 120 Wet Madin Sred Sulle 718 Chicag llini l f public auctin l the highet bidder fr cah el frth belw the fiiwin decribed mrtgaged real etate: PN 1026111006 Cmmn v knwn a 7735 Eat Prairie Rd Skki L 60076 The mrtgaged real etate i in prvud with a ingl family reidence Sai term: 10% dwn by certified fund btnce by certifed fund within 24 hur N refund The prperly will NOT be pn tar npectin Fr infrmatin cali William E Dultn Jr/Barbara J Oufln al Plaintlffttrney DUTTON & DUTTON PC 10325 Wet Lincln Highway Frnkfrl llini 60423 (815) 0068200 NTERCOUNTY JUDCL SLES CORPORTON Selling Officer (312)4441122 1176484 Publihed in Pineer Pre 430 7 5/14/09 (1688349) C SKOKE N THE CRCUT COURT OF COOK COUNTY LLNOS COUNTY DEPRTMENT CHNCERY DSON HSBC BNK US N SSGNEE OF OPTON ONE MORTGGE CORPO RTiON Plaintff v MCDNNE EDMONO Defendant 03 CH 37778 NOTCE OF SLE PUBLC NOTCE SHERE ßY GEN that puruant jjudgrnenlf Freclure and Sal entered n litabye entitied caue n January 27 2009 nlercunty Judicial Saie Crpralin will n Tueday 695 Judical Sale May 19 2009 f the hur f 11 am in their ffice at 120 Wet Madin Street Sulle 718 Chicag llni ell al public auctin the highet bidder fr cah a l frth belw the fllwing decrlbed mrt000ed real etate: PJN 1023402051 Cmmnly knwn a 8317 SUth Lui venue Skkie L 60076 The mrtgaged real etate i imprved with a ingle family reid;jce Sale term: 10% dwn by certified fund balnce by cerfified fund with n 24 hur N refund The prperty will NOT be pen fr npectin Fr infrmatin cil Sale Clerk at Law fice f ra L Nevl 175 Nrth Franklin Street Chicag il lni 60606 1312) 2571125 NTERCOUNTY JUDCL SLES CORPORTON Selling Officer (312)4441122 1174475 Publihed n Pineer Pre 4/16 4/23 40W09 (1684384) C Marketplace 705 Pet dvertie 700 24/7 Call (847) 9983400 Email Claltied@ pineerlcalcm Onling htlp :\erder pl0000rlcalcm Fa (841) 4867497 P1NEERFRJ;S 5OUR LOC $OURCB tk!ub 708 nflque and rt Gd PNE WRTNG PEN5 FOUNTN PENS 29th nnual Chicaq Pen Shw Spnreby KRONE PENS Cpnred by GREGORY N SCHS STY LUS and Pen Wrld ntl WESTNONRE 6100 Rver Rd Remnt L Sat/Sun Muy 2 8 3 adm $25 Sunday admiin May 3 10:004pm$5 Pen fr Kd Prgram Sunday at 12:00 Specal Parkng rle al $700 MODERN/NTGE PENS NKS NKWELLS ETC Over 170 Pen Manufacturer Relatler ntage Pen Dealer Giye awy & Dr Price Fr nfrmatin clt the Wetle 01: 8416986000 Buying r Seing Pineer Claified i the place fryuf (847) 998340ò 717 uctn Sale NTQUE UCTON Tueday May 5 3 10:30 PM 7232 N Wetern vechge Several Etafe Cngnmçnfl nclude:sgd Limbert Bkcae 0 Slicicty Br Miin Oak Rcker; ntique Furniture; Cntemprary Furnilure nc Henrdn Kindl Beacn Hill etc; Steuben Lalique Baccarat & Other Fn Gla; Revitie; Weller Pr Clumbian tem & Cllectin f ndian Pttery Mak & xe Head;Gtd Diamnd & Silver Jewelry; Waiche & Pcketwatche; Ctume Jewelry; Gld & Sllvr Cin; Orienlal Rug; Light Flxture;Mre Over 600 Llt Prevew: MnMay 4 3:30 7:30 PM & 1 Hur Befre Sale See Full Liting 8 Pht at wwwdlrectauctlncm Cnlgnmenl ccepted Pc r Entre Etate 723 Buildng Supplie 01cl Barn and Barnwd Wanted f yu wnt t buy and ell ld barn r barnwad ea u at: www Thßarnpagecm 734 Cnducted Hue Sale SCHLLER PRK MON STER ESTTE SLE 4702 N i(ize FRSTSUN May 1 3 9:004:00 Furn nc 1930 BR Set; Retr SO DR Set; Dreer Tbl; Lamp; Whr/Dryr; Rairig Bike; Lawn Mwr; Tl; Gun Equip; Fihing Rdcc; Knive; XMS; Retr intge Cllh; Old Ty; DD; Gaming; Jwlry; Glwr; Rcrd; T; Electrnc; Hehld; Walche; Baeball Crd; TONS MORE Plc1nf 60 wwwemeratcfalblz # at e Frl nly 6309130326 735 Gamge Hue ale CHCGO5461 N Nwland Sat 5)2 9a4p CONTENTS SLE 1930 ak buffet vint Zenith rund tube T 1940 watrfall chet f drawer 1950 full ize BR t picture ail Grman china fr 10 hideabed brica brc dek lamp turn kit item hu day decralin gd quality huehld item Cnducted by Calic Cat ENSTON Tle ElmWd ve May 2 012 Mvng al: lay hueware turnitur grat luffl GLENEW GRGE SLE item md hueware gardning equipment wdlip bl & upplie electrnic printer cmpulr uppii phtgraphy upplie tri Pd ceramic & gla inullr Lille Giant Ladder PD celi phne alarm clck T tand chair Stl heep kin picture frame exrcie equip men alf club etc May 22 earn 2pm rain r hine 816 Windr Rd (malar lnlrclin Wagner & Glnviw Rd) LNCOLNWOODS0 May 2 9am4pm 6600 N Lery Multifamly Garage Sal Hueware cilhipp anliqu art baby furniture Smethng fr everyne Nil ES 7806 W L Cf il 52 9a4p Rechner beaul din rm BR t SunRay tve rzr vlg child chrm abiachair china kil & mrel Pic n lalalenetnilal by Regal Hrr Sale kp NORRlDG tatesale 8512 W Gidding Frl May 1 82 & Sat May 2 812 Chamber ven turn cl hhld 708 6385084 by nllque N Stult 735 qaraqe Hue gale PRK RDGE 1234 Cani held HUGE GRGE Lr Sat Sf2 9am3pm nlique 8 much micl PRK RDGE 362 utin & 349 Ulin Nay lt2nd 84pm ntique & Treaure PRK ROGE42OS Clftn FriSun 5/1 5/3 90m 4pm NH Clth turn Steve dihe PRK RDGE 921 Wley (½ bik S f Oaktzu/lgnqu;n) Sal Sf2 Oam4pm MULTFMLY PRK RDGE Fri May it 9a3p 172 W Kathleen Dr Daybed exercie bike cleaning ut lt mre SKOKE GRGE SLE 4950 Oid Orchard Rd loa4p Fr1 Sat Sun May 1 2 and 3 E f Eden Expy ntique intage chna tl clthng glf ty camera WLMETTE HUGE MULT FMLY SLE 600641 KNOX 2 93PM HUGE SELECTON: CLOTHES OSHES&MORE WLMETTE Sunday 95 410 Rdge Read YRD SLE GRGE SLE NDOOR SLE 70 dealer antique emprium Graf bargan HERTGE TRL MLL (847)2566208 RN OR SHNE WNNETK 455 Maple St Sat May 2 8 2 Winntka Wman Club rummage ai Clthing ty bk furniture mic Cah nly 736 Flea Market Giant Spring Rummage Saie NEW DY St Jahn Rummage Sale STURDY May 2 7am 3pm 1235 Wllmett ve Wilmtte ll day nack bar Jewelry Gft Shp French Rm Bk Hueware Ty Clthe 8472511130 755 Mcellaneu 1000 Recrd Cllectn 50% never played purchaed in tit 50 & d 8473l80276 an mach 8413180289 DRECT FREE 4 Rm Syfenii 265 4Channel Start$2999 FREE Ne Shwtim Starzl 130 ND ChanneliFREE DRHDt N Start Catt Dirct5tarT Lcal ntallerl 18009739ß44 FREE DRECT4 Rm Syteml 265 i Channeli Start $29991 FREE HBO Shwtirn Starzt 130 HO Channit FREE OR/HD N Start ctt Direct StgrT 18002167723 STEEL BULDNG NO SZE WELCOME Spring SPECLS Stl Price r DOWnDDTONL dicunt available Dnt Waitt Wrld Cla Srvic CLL NOW t wwwgreyicnteicm 18668028573 770 Rummage Sale 59TH NNUL SPRNG RUMMGE SLE ST MY 2 7am4pm t Prebylerian Church 700 N Sheridan Rd Lake Fret L Clthing She Furniture Jewelry Hueware Sprt Traur Garden ur famu French rm & mrel Credit card accepted ll prceed te lcal charitie wwwl5tprofrummageg St Mark Rummage Sale RidgeGrve Evantn MayZ 9amt 1pm Myer ictrian Organ 790 Wanted t Buy neguen Clciitl: Old ty advertiing gardn tatue urn crck 7737181928 wwwpineerlcalcm 790 Wanted t Buy Want t buy yur ued recrd autgraph and mucrelated r Bat le temvintge lyl buy Whle Cllectn Dan 1139127351 WNTED NOME STEREO Equip & Recrd 334578 Will pckup Cath 8412660190 utmtive 900 910 ntique & ClaSic Car 4 Call (047) 9983400 Email Ciaified@ Plnericalcm Online http :rder pionoricalcm Fax (847) 4867457 PONEER1RESS Ytic LOCL Suce tk LTjfl5 935 utmble Private Party BMW2000S4O 6d Black Sprt pkg 60K ml 1 wner BEST OFFER (841)5022289 Our utmtive Sedin ha the Cr yu are lking fr Buying r Selling Pineer Claified i the place fr yu! (84 7) 9983400 936 utmble Dealerhip GRET DELS ON WHEELS 2802 Nan ltlma Ȧutfulj pwer 91995 2008 Chryler Sebring mlled cnvert adedll $19995 2002 Hnda ccrd EX 6 eathermn adedl $9495 2008 Chryler Turng Lt r laded $10995 2005 Jeep Lberty 4x4 Full pwer $12995 2005 Jeep Wrang 1er 4x4 One wneraut 6cyc $14995 2007 Chryler Sebrlrig Turng 17k mle 4 cyl full pwer $12995 2007 Jeep Grand Cherkee Lared4x4 13k mllel $17995 2003 Chevrlet S10 Pckup $1595 2008 Chevrlet Cbalt LT Full pwer $11 995 2504 Frd Tauru SES Full pwer 50k mlle $7995 2005 Chryler PT Cruier utjc19i( mle $12995 2001 Ddge Cabr4 dr Full pwer $12995 2006 ChrylerTwn & CunlryTeuring Mlnlvan Laded Stew & g $13995 2006Jeep Lberty 4x4 $12995 2005 Jeep Grand Cherkee 8 laded $13995 2006 Jeep Grand Cherkee Lared ealhermnraf $14595 2008 Dede venger utarß mr $12595 2007 Frd Fcu 8k mi $10595 2007 Pntac 06 edan $12995 Waltn Pr Driven Car 5050 Damptr St Skkie L (847) 6737601 947 utmble Wanted CSH FOR JUNK CRS Free PickUp Same day Service Cali 7088042228 Legal Ntice Pineer Pre Publicatin (rc) 1008 umed Name dvertie Leqal 24/7 Call (841) 4866827 Email legal@ plneerlcicm Fax (841) 4867417 vu LOcl augen 1i LTùt SSUMED NME Ntice hereby given puruant t n ct n relatin t the u f an umed Buine Name in Oh cnduct r tranactin f Buine n the Stale a amended that a certificatn wa filed by the underigned with the Cunty Clerk f Ck Cunty File N D0911756 n pril 22 2009 under the umed Name f Ditnctive Event Plannng with the buine lcated 53 W Jackn Blvd Suite 1531 Chicag L 60504 The true name() and redence addre f the wner() i Gall Grdnllen 1719 N Newland ve Chicag L 60707 and Beatriz Swlch 5629 S Kahn ve Chicag L 60629 Publihed in Pineer Pre 400 5/7 51141g9 (1689053) C SSUMED NME Nlice i hereby given pur uant t n ct n relatin t the ue f an umed Bu ne Nme in the cnduct r tranactin f Buine in the State a amended that a Certificatin wa tiled by th underigned wilt the Cunty Clerk f Ck Cunty File N 009111461 n pril 15 2009 Under the umed Name f HOMEMDESTHE BEST With flic buine lcated at 10705 S lbany vg Chicag L 60655 The true flame() and reidence addre f the wner() Eileen H Turner 10444 S Chritiana ve Cttcag tl 60655 Jacquelynn Stver 10705 S lbany ve Chica 00 L 60655 Publihed n Pineer Pre 4t23 4/30 5/7/09 (1686813) C SSUMED NME Ntice hereby given puruant l n ct in rlalin ta h ue at an umed Bu fl Name n the cnduct r ranactin at Buine in the Stte a amnded that a certificatin Wa filed by te underigned with the Cunty Clerk f Ck Cunty Fil N 1309117542 en pril 21 2009 under the umed Numf J & E Cencrele Flr Cleaning Servce wilt the buine lcated al 3321 W Belmnt ve Chicag L 60618 The true camel) and reidence addre f te wner() i Juan J cta Navarr 3321 W Belmnt ve Chlcag L 60618 Publiztid in Piner Pre 4135 5/7 Wt49 (1688788) C Bngr Seir Pineet ClSifieti S ihprce fyu 1008 umej Name SSUMED NME Ntice hereby given puruant t n ct n relatin t the u f an umed Bui ne Name n the cnduct r tranactin f Buine n the Stl a amended that a CertiflcOtln Wa flied by the underigned with the Cunty Clark f Ck Cunty File N D09117445 en prii 14 2009 Under the umed Nme f WNNNG BD UCTONS with the buine lcated at 1264 Larchmnt Dr Elk Grve iltage L 60007 The true nme(e) and reidence addre f the wner() i Gbe Klley 1264 Larchmnt Dr Elk Grve illage L 60007 Jee Padren 278 Caldy Ln Elgin L 60124 Publihed n Pineer Pre 4123 4/35 W7109 (1606275) C SSUMED NME Nlic hereby given puruant f n ct n relatin l Oh ue f an umed Buine Name n Oh cnducl r tranactin f Buine in the Stat a amended thl a Crtlficatlrjn wa filed by the underigned With the Cunty Clerk f Ck Cunty File N D09117561 n pril 22 2009 under the umed Nm f Edgwater Tutring with he buine lcated SOOt N Sherdan Rd 12D Chicag L 60660 The true name() and reidence addre f the wner() i Bldizar Lau 5901 N Sheridan Rd Chicag L 60660 Publihed n Pineer Pre 430W 5lJ49 (1489078) C SSUMED NME Nlice hereby given pur Suant t n ctn rllin t the u f an umed Bune Nme in the cnduct r tranactin f Buine in the Stat amended that a Certificatin wa filed by the undergned with the Cunty Clerk f Ck Cunty File N 009117472 n pril 15 2009 under the umed Name f DMOND GROUP DESGN with h buine lcated at (1) 2018 Lake St #B Evant L 60201 (2) 2115 rthur #3 Chicag L 60645 The true name() and reidence addre at the wner() DngelW Seater 2115 rthur#3 Chicag 1L60645 Publihed n Pineer Pre 4/23 4/30 5/7/09 (1601225) C SSUMED NME Ntice hereby gven purun t n ct n relatin t the ue f an umed Buhne Name in the cnducl r tranactin at Buine in the State 05 amended that a certificatn wa filed by the underigned wllh the Cunty Clerk f Ck Cunty Fil N 009117459 n pril 16 2009 Under the umed Nm at EWLOR with the buine hc010d at 9238 N Greenwd ve Oe Plaine L 60016 The true name() and reidence addr f le wner() Trnan Pitr Mhed 9238 N Greenwd ve De Plaine ll600t6 Publihed in Pineer Pre 423400 MiitO (1687188) C SSUMED NME Ntice i hereby given purunt l n ct n relatin t the ue f an umed Buhne Nm in the cnduct r ranctin at Buine in the Slate a amended that a certificatin wa filed by the underigned with the Cunty Clerk et Ck Cunty Fle N 009117500 n prii 17 2009 under the umed Name f Flttee Trend wilt the buine lcated f 5936 Cleveland St Mrn Grve L 60053 Te true name() and reidence addre f lhe ewner() i ntania Rla and Rbert J Ral 5936 Cleveland S Mrtn Grve h L 60053 Publihed in Pineer Pre 4/23 4/30 7Ñ9 (1687181) C lt t! i lt i N N e DOS umed Name loo8umed Name 1008 umed Name 1010 uctn 1013 Bd Ntice 1O13 Bld Ntice 1013 Bid Ntice 1046 Lien SSUMEONME Nutic i hereby given purjan? l n ct in relatin t tuant e ue Of On umed Bu the :55 NniO in the cnduct r ne enclln f Buine n the tranactin late OS mnded that a ;rlillcllofl WOO flied by the certiticatien ndritlfled wilh the Cunty lerk f Ck Cunty File DD9l174f6 n pril 15 109 under the umed 2009 lam f TURBOCRUS ilk the bune lcated at 55 DuliOS Rd pt C De laine L 60016 The true meli and redence adr f hn wner() anu; KuOmO 155 Dulle 6 (ipt C Oe Plaine L 0016 Publihed in Pineer Pre 423 4/30 7Ñ9 (1686856) C SSÙMEDNME Ntice hereby given purt n ct n rlallan te uant ue f an umed Bui the Nahte in the cnduct r ne f Bune n the tranactin Stale a amended that a Slate wa filed by the cerlificalin underigned with the Caunly Clerk f Ck Cunty File N 009117407 n prl 10 under the umed 2009 Name f MMH RELTY GROUP with the buine lcated at 1412 S Wahingtn Park Ridge L 60068 The true name() nd reidence addre f the wner() Maureen McGulre 1412 S Wahingtn Park Ridge L 60068 Publihed n Pineer Pre 416 423 4Z09 (1685329) C SSUMEDNME Ntice hereby given purte n ct in relllen h Strage ue f ai umed Bui 2525 Name n the cnduct r Chicag f Buine n the amended that a wa tiled by the underigned with the Cunty Clerk at COOK Cunty Pite Ne 009117476 n pril t5 under the umed n Name f M P Mrr Centructin with Oh buine lcated at 4131 N Dickinn Chicag l 60641 The true name() tram nd reidence addre el the wner() i: Michael P Mrri 4131 N Dickinn Chicag L 60641 Publihed in Pineer Pre 4123 5/7/59 (16867321 C NOTCEOFP(JBLCSLE PLCE: The L ck Up Sell Center W rmitg li 60647 DTE : May 20 2009 TME: 10:00am CONDTONS: lt unit will be ld t the hghet bidder Bid tken nly fr each unit l entirety Payment mut be mde by cerlilied chck Cah r mney ardr nly N pernal check accepted LL gd mut be remved hip the unit within 24 hur 219 Payment due immedately upn acceptance f bid Unt avihbllily ubiect t prir ettlemenlfccunt Unit 1063 Bartn Fal Bxe bin artwrk Unit 1064 Bartn Fal Bxe cdc artwrk bin Unit 3515 Garret Mre She bag tie mattre chair trame Unit 2030 Maltiw Segel Maltre rack clthing chair bxe Publihed in Pineer Pre 4/ 7/ (1688655)C BDONGNDCONTRCT REQUREMENTS SECTON O3S Schl dvertiement fr Bid RidgeNile BD RELESE $4 S cepthng Wrk (Rebld) Landcaping CeramcTl (Rbld) allen Hile Twnhp HS Dtrct year 219 ficlin Captal mpreventnte pick Summer2OO itrallve Seated bid will be receved by HC Cnlructin Camp due ne LLC fr the Nue Twn al High Schl Dllrcl ri Thurday May 21 2009 lcly at 2:00 pm prevalng time al the Hile Twnhip Hgh regardng Schl Ditrict Ottice tar the cntact Summer 2009 Captal m 8473184321 prvement Bid Releae #3 Lump Sum Bid Prpai will be received until the cheduled time f cling the receipt f bid and lin will be publicly pened at that lm fr Bid Releae #3 The Trade Package ncluded re: Trade Package 2: Sil Wrk Trade Pckaee2B: Lndcapingand rrigatin Trade Package 9B : Ceramic Tile Bid ecurity in he frm f a bld hod certified check r cah in an amunt eauai t 10 percent f the lutai bid amunt hall be ubmitted with the bld Shuld a bid bnd be ubmilted the bid bnd hall be payable t the Bard 01 EducatiOn Nue Twnhip High Scheel Oitrlct N 219 Bid hall be ubmtted n r befre the pecified cling lme n n paque ealed envelpe addreed : Mr Paul OMaliey llnt Superintendent fr Buine Service 1411e Twnhip MS Dtric # 219 ilgr pint Rd Skkie L 60077 Envelpe huld be clearty marked Seled Bid and u the Trade PackUg Nun ber The Bard t Educhin reerve the right l relect any r ail bid r prt thereat r waive any rregularitie r ntermelllle and O make n award tha n 111e Bard pinn i in the bh interet l the Dtrict ll bidder mut cmply Wth applicable llini Law requirng the payment et prvailing wage by all CntraetrwrkinOOflPublCWOrk Bidder mut cmply wilh the llin Statutry require mnt regrdlng labr ncluding Equal Emplyment Opprtunity Lw The ucceful bidder will be required t turnih a pertrmancu bnd and payment bnd he wner equal t el the Cntrcl mullt The ct f the perfrmance g payment band will be includd in euch bidder Prpa The ucceful bidder will be required t furnih nurance equal t r greater t;an the pecilied amunt and cnifin The ct at the inur ance will be ncluded n each bidder prpai Bidding Dcumnlu will be made avalable n CD frm thc Cntructin Cmpany 1500 Eecutive Drive Elgin L 60123 Cntact Carlyn Bickert 60 8472163924 r by mail: cbickerlw hccntrucllncm Bidder wh receive plan frmn ervice uch a Ddge r Reed mut cntact NC Cntructin Cmpanie t get prper bid frm and ddenda quetin huld be addreed in writing vi email t NC Cntructin Cmpanie LLC; tn: Graeme Fter glter@ liccntructioflc0m r via fax 8472143911 Quetn ubmitted le ttan an week prir t the bid pening cannlbec005idred Emait: gltr ihccntrucllncm Tel: 0412143907 Publihed n Pineer Pre 4130/09(168904t) C CmlîiUnil BDFORF000SERCE Cnlidated Ntice Ditrict 64 Park the llini ac lner bid fr 1fb manage Ditrict mnt f ur fd ervice per bid fr the 20092010 chl fr: intructin and Spedar available fr up f the Ditric dmn Ottic tcled al 164 Mandatry Prpect venue Park day Ridge L 60068 ll bid are Skkie May 10 2009 at 1000 am Center the abve addre f which time they will be pub Specificatin pened and rad alud prpective Fr addlllnat inlrmatlon Purcha1ng the bld pleae lcated Belly LatlanziO h Center publihed n Pineer Pre The 3O/09 (1688063) C iner Place accept LEGLNOTCE REQUEST FOR DD hereby gven that Beard at Park Cmmi al 01 the Skkie Prk 2552 will receve and pen 60629 n May 14 2009 al 10 am trce Securlly Camera twing Site iit Tuc May 12th 10am at the Park Ditrict Weber tim ar n tile tr bidder at the Manager ttica al Weber Liur 9300 Weber Park Skkle L Bard f Park Cmmi reerve the right l r relect any and all er prtin thereat and waive techncaltie Sealed bid are te be addreed t: ndrew Butta Purchaing Manager Skkie Park Dilrlct 9300 Weber Park Place Skkie L 60577 Security Camera bic encled Publihed in Pineer Pre 4/30/09 (1680575) C2 ta the LENSPUBLCNOTCE On Junelt 2009 al 10:00 M Super ut Repair nc W lit S Ctilc000 L hall prceed t ena len under the law at Stat f llini fr haber materal ervice lr090 & lher fe acltd theret Strage charge cntinu t accrue Sal may be cenlinued frm lime t withut further ntice with eceptin t pern altendng cheduled le Succelul bidder required t pay with certified fund Owner: Rdlf Zamra Lienhlder: merican General Finance ehicle: 1997 Frd N 0 FMFU8LOLOÓ176 munt awed: $199500 Publihed n Pineer Pre 400109(1689043) C2 SSUMED NME Ntice hereby given puruant l n ct in relatin t the ue f an umed Buine Name in the cenducl r tranactin al Buine in the Slale a amended tha a certficatn wa filed by the underigned with the Cunty Clerk el Ck Cunty File N 009117306 n pril 9 2009 under the umed Namet LUNCH TKS with the buine lcated at 4001 S Maplewd ve pt 2 Chicag L 60632 The true name() and reidence addre f the wner() i Lui J MantecaMarliflez 4001 S Maphewd ve pt 2 Chic L 60632 Publihed in Pineer Pre 4116 4123 t/3w09 (1655429) C BD NOTCE bid Cmmunity Cnlidated Schl Ditrict 64 164 5 Prpect ve Park Ridge L wilt accept bid fer carpet replacement Spciticalin may be requeted frm the Bard Office 164 Suth Prpect venue Park Rdge L 60068 Bd are due and wll be publicly pened and rad May 12 2009 at 2:00 pm Bidder are nvited te attend he pening but their Oreenceintrequlred Betty LatlnziO Purchang Manager Publihed in pineer Pre v3/9 (1689038) C SSUMED NME Nlice i hereby given purcl ct n relatin t h ue t n umed Bui es Nm in the cnduct r rnnciction et Buine n the tt a amended that ertiticlion wa filed by the ndrignod wilh the Cunty ;lrk t Ck Cunty File M 009111465 05 pril is t under the umed meel rhespphregllery OF CHCGO clc the buine lcated at 234 W Clumbia pt 2 Ch 500 L 60626 The true iml) end reidence adre ut hn wner() Peter tr055 1234 W Clumbia pl 2 ChiCag L 60626 Publihed n Pineer Pre 123 30 5/7/09 (1686854) C SSUMED NME Ntice hereby given puruant te n ct in relatin t the ue f n umed Buinu Name n the cnduct er tranactin at Buine in the Slate a amended that a cerlificatln wa flied by the underigned with the Cunty Clerk at Ck Cunty File N De9117362 n pril 8 2009 under the umed Name at TRUELSEN MED SERCES with the buine lcated al i Freemn Rd Hffman Etate L 60192 The true name() and reidence ddre f the wner() Stewart R Truelen 1545 Freeman Rad Hffman Etate L 60192 publihed in Pineer Pre t/16 4/23 v3w09 (1685230) C LENS PUBLC NOTCE On June it 2009 at 10; 00 am at CHFS NC 222 hmer Rd # 2 Chicag leieht L 60411 a aie hall prceed l enfrce lien under the law f the Slate f llini tar labr material trage tw ing and ther lee acialçd theret Strage charge cntinue accrue SuccSlul bidder requred pay with certified fund The ale may be cntinued frm time te time withut turther ntice except tr partie altendinci aie r partie requetng aid lntrmalin Owner: Marin Krt ehicle; 1992 Tyta N:JT3C12R4N1059023 munt Owed: $186400 publihed in Pineer Pre 9u1605974) C2 1023 Divrce N THE CRCUT COURT OF COOK COUNTY LLNOS COUNTY DEPRTMENT DOMESTC RELTONS DSON N RE THE MRRGE OF: NN M HRRS Petitner and WLLE L BRYLOCK Repndent Cae Ne 89 D630326 NOTCE BY PUBLCTON The rquiite allidvu fr publicatn having been filed NOTCE S HEREBY G EN YOU WLLE L BRYLOCK RpendOnt la? thi c3o ha been cmmnced in thi curt by the Petitiner againt yu fr dilutin t marriage and thr relief UNLESS YOU file yur anwer r therwie lil yur appearance n thi cae in the ffice Of the clerk at thi curt lcated at Markham Curlhue 16501 5 Kedie Pkw Markham L 60426 n r betre May 23 2009 a default iudcmenl may be taken againt yu lar he ruet aked n the petitin /0/ Gerald Bauer Jr ttrney fr Petihiner ttrney N: 41403 Publihed n Pineer Pre 4/2 4/30 5/7/09 (1687169)C NOTCEOF PUBLC SLE OF PERSONL PROPERTY Ntice i hereby given 1h01 puruant t Sectin 4 0! lhg SelfService Strage Facility ct Slate el llini thin undrlgned will ell at a public ale by cmpelllive bidding n: 5/15/2009 at 4:00 pm On the preme where aid prperty ha been tred nd which are lcated t Public Str000 FOSTER RENSW000 SELF STORGE LLC 1000 W FOSTER E CHCGO L 60640 7735615003 The pernal prperly l dcribed belw n tle mller et: Spce $012 Perkin Wyne Furniture Spc #107 Jackn Ridge Trut Full ut bxe Spce #653 Gallard ernica 1 T bxe 1 mcrwave Space #851 Cyle Li Fuil f furniture publihed n Pineer Pre (t6o4slc BD NOTCE NUe Twnhip High Schl Dllricl 219 will receive ealed bid far the purchae al Twel Service fr he 2009 O chl year up l 2:00 pm Mnday May it 2009 at the Buine 011lc f Ditrict 219 7700 Gr Peint Rad Skke L 60077 Bid will therealter be pubhicly pened and rad alud Speclticalin el hem l be uplied may be btained tram the Buine 0111cc at the abve addre n Fr lurtlier ntrmatin c tact: Jean Hedtrm Purchaing genl Ditrict 219 Buine Office 8416263978 Publihed in Pineer Pre 4t3009(t6889B5 C SSUMED NME Ntice i hereby given puruant t n ct in relalin t the ue f n umed Bui 5055 Name in the cnduct r tranactin f Bulne5 in the State a amended that a certllicatin w flied by 11:0 underigned with the Cunty Clerk f Ck Cunty Fil N 059117355011 prl 8 2009 undertheumed Namet NTEGRTY JNTORL SERCES CO Willi le buine lcated et Bx 34090 Chlc000 L 606310090 The true nomo(s) and reidence addre ut the wner() i Richard Bubenheiflier 3641 N Newcatle Chicag L 60634 Publihed in Pineer pre 4/16 4/23 309 116853461 C SSUMED NME Nlic S hereby given purs O n ch in relatin t h ue ut n umed Buile Name in the cnduct r ranclln f Buine n the itt a amended that :rtiticti WOO filed by the uiiderijnod with the Cunty Clcrk et Ck Cunty File N 009111463 n pril 15 tt under the umed Nan;e et WORKOUT PRTNERZ itli the buine lcated at vi /el Clicae ve Chicft L 60622 The true narneli and reidence dlie el the wner() llen J Kecl;inky 19 King rthurcurl Unit 13 Nrihlake L 60164 Publihed in Pineer Pre 4/23 4/30 5/7/09 11686041) C SSUMED NME Ntice i hereby given puruant t n ct in relatin t thp ue at an umed Bud Name n the cnduct r tranactin f Buine n the State a amended that certificatin wa flied by he undergned with the Cunty Clerk f Ck Cunty Plie Na 009117317 n pril 3 2009 under the umed Name f CLENNG GREEN HOME with the buine lcated al 2633 N Meivina Chicag L 60639 The true name() and reidence addre et tte wner() i Erice elaquez 2633 N Mivina Chicag L 60639 and Glri ega 5758 Califrnia ve Chicag L 60629 Publihed in Pineer Pre 4t6 403 4/3/09 (1685085) C LENS PUBLC NOTCE On May 28th 2009 at 10:00 M at Nrth Chicag ul Service 2055 ML King Jr Dr Nrth Chicag L 60064 aie entrc lien under the lw f the Stle f llini fr labr material ervice trage lwing 8 ther fee aciated theret Strage charge cntinue l accrue Sai may be cantinund frm lm l lime wthut lurther ntice will exceptin t pern attending ctiedulet ate Succtul bdder required t pay with certified fund Owner: Freddie J Mrri Liehlder: Drve Financial Service ehicle: 2004 Chevrlel i N # 1 G N E Cl 384J228423 muntwed: 5132550 Publihed in Pneer Pre v234/3w09(168494lc3 BD NOTCE Hile Twnhp High 5l Ditrict 2)9 wll receive ealed bid fr the purchae f tw FRS Standard CNC Ruter and accerie tip t 2:30 nm n Mnday May 11 2009 at he Bulne Ottic f Ditrct 219 7100 Gra Pnt Rad Skkle L Bid will tttereatlr be pubilcly pened and read alud Specificatin f ilem t be 5Uulp1 may be btained frm the Bune Ottic at the abve addre Fr lurthr inlrmatin cntact: Jan ttedtrum Purchaing gent Ditrict 219 Buine Office 8476263918 Publihed in Pineer Pre (1984) C SSUMED NME Nlic i hereby given puruaet t n ct in relatin O he ue el an umed Bune Name in le cnducl er tranactin f Buine in the State amended hht a cerliticatln wa tiled by the underigned with the Cunty Clerk et Ck Cunty File N 009117309 00 pril 9 2009 under the unld Nm el 00000n with the buine lcated at 405 N PlumWOOd C Schumburg L 60173 The true name() and ieldence addre ut the wner() Tal Le 405 N Plumwd Ct Schaumburg L 60173 Publihed in Pineer Pre 5/7/09 (1685720)C SSUMED NME Ntice hereby given purun t n ch in relatin t the ue et an umed Buine Nme n the cnduct r tranactin f Buine n the Stale C amended 1h01 a certficatin wa filed by the underigned wilh the Cunty Clerk f COOk Cunty Flic N D09117385 On pril 9 2009 under the umed Nme f MPSON ELECTRC with the buine lcated at 2945 N Sayre Chcag L The rue name() nd reidence addre al he wner() TerrY L Lampn 2945 H Sayre Chicage 1L60634 Publihed n Pineer Pre 4/23 4t30l (06854201 C Buying r Selng Pineer Claified SSUMED NME tilice i hereby given nuruant n ct n rtatin t thy ue el an umed Bufl Nni in the cnduct r tri;clin et Buine n the Stale amended hat a cerliticelien wa tiled by the Underigned willi the Cunty Clerk el Ck Cunty File N DM117462 n prl S 7009 under the umed hume f WDSERCE Willi hie buine lcated at 2143 W Waltn pt 3 Chca n L 60622 The trug eiflell nd redence ad dre ut the wner() i Oih Ollkevych 2443 W Wllen pt 3 Chcag L 60622 Pubiihlin PineerPre ti23 4/30 5/7/59 (1686823) C SSUMED NME Ntice i hereby given puruant l n d n relatin O the ue f an umed Buine Name n the cnduct r tra50chb0 at Bune in the Stle a amended that a cerlilictin Wa filed by the undergned with the Cunty Clerk f Ck CuCh File N 009117281 n pril 1 2009 under the umed Name f zertli with the bune lcated a 2354 S Gebbert p 2063 rlingtn Height L 60005 The true name() and reidence addre at the wner() i Macil Zuchwkt 2354 5 GOObberl pt 2063 rlingtn Height L 60005 Publhed n Pinerpre 16 4/23 4/3q09 (1603661) C NOTCE OF PUBLC SLE TO BE HELD T: THE LOCK UP STORGE 350 W Kinde Chicag L 60610 DTE: May 5 2009 BEGNS T: 10:00 gm CONDTONS: li unit will be ld t tle highet bidder Bid taken nly tr each unit in it entirety Payment mut be made by certified chck r mney rder nly N pernal check r cah accepted li gd mut be remved frm he unit within 24 hur Payment due immediately upen acceptance t bid Un availablity ubiecl t prir ettlement f accunt Unt 4408 Kevin Reynld Bue carpet rt lamp er bin Unt 1625 Challty Parker Stl bee Publihed in Pineer Pre 4/23 4/3 (1606504) C Buying r Selling Pineer Claified S the place fryu! Buying r Selling Pineer Claified th place fr yul BD NOTCE The Bard f Educatin t Rldgwd High Schl Olitrich 234 receivng bid lar Fitne Equipmen Bid packet may be picked up at Ridgwd High Schl Buine Ottic Bid hall be ubmltled t M CherYl Flint Bune Manager RdiOwd High Schl Ditrict 234 i" Mnlr050 ve Nrridge L 60706by2:00 pmnmayl22009 PubllhedinPifleer pre (1688773) C SSUMED NME Ntice i hereby given pur 55551 ten ct n relatin t lire ue f an umed Buine Nni in the cnduct r rrnctin f Buine n the Stle amended that crlitictln wa tiled by the Underieed will the Cunty Clerk el Ck Cunty File N Dttt6lt n pril 14 2009 under the umeci Nmel M Expre with hie bune lcated f 1116 E Orchard St rlngtn Niçjlit L 60005 The true einll and redence ddr uf le wner() : Gne McCabe 1116 E Orcherd St rli HigN L 60005 ngtn Publihed in Pineer Pre 4f2] 4/30 5/7M (1606736) C SSUMED NME Ntice here ven purb el uant t n ct n relatin t the ue f On umed Buine Nme n the cnduct r tranactin f Buine in the State 05 amended that O certificatin wa filed by the underigned with the Cunty Clerk at Ck Cunty Fle NO 0091174M un pril 15 2009 under the umed Nm f CSTROCONSTRUCTON wilh the buine lcated at 2200 Wet Evergreen Chica QO L 60651 Ttie true name() and reidence addr f the wner() ngel O Catr 3300 Wet Evergreen Chicag L 60651 Publihed n Pineer Pre 423 4/30 5/7/09 (160685e) C NOTCE Ntice Hereby given that ll the pernal prperty viin f the llini Self 95) The ale will be cnducted cnditin f aid ct ter the erllen tr rent labr and ct The ai will be cnducted day May 13 2009 n r aller Strage lcated at 7540 60076 by Jeff Brwn #4440000172 Purchae mut be paid fr Sl ubiect t cancellatin lwen wnernd bligated OF SLE the undergned intend te decribed belw under the pr Service Facilty ct (770 LCS puruant l the term and purpe f atifying an wnther charge pecllied n the by cmretltive bld n Wedn 10:00 M al Extra Space McCrmck Blvd Slckle L at ce uctineer Lcene al tim f purchae in cah in the evenl f ettlement beparty Bxe cmputer be Furnture rug C uni bird cage fa Be chair Furniture micrwave Furnture freezer 23 4/30 5/1/09(1686927)C35 Buying r Selling Pineer Claified the place 0 0Ui Unit #1014 Bruc Chrlene: Unt 52028 Jacke Schur: Sla Unit 02299 JePh Brk: Uni #1007 Yuberl yuktana: Unit 12293 Patric Brk: Uni #1054 Carline Nute: Unit #1077 Cecehla Edward: Phd in Pneer pree Buying r Selling5 Pineer Cied the plce fr yul Buying r Seil ng Pineer Caied he place fr yuf Bngi Selling Pwetcledhi iileieyvl th place fr yu! pineer Pre Publicatin (Dc) wwwpineerlcalcm Thurday pril 30 2009 B

B Thurday pril 30 2009 1046 Len PUBLC UEN SLE Ntice hereby Gven tho n May 8 2009 al 9:00 Gm ø ale w( be held at MR O TOWNG & UTO SLES 300 E 69th ST CHCGO L 60637 t ell The fllwing arcl t enfrce lin extng under the law 01 the Stat 01 llini againt uch artcle fr labr ervice kill r materia) expended upn Strage lurnlhed fr uch rlide al the requet at the titwing deignated unle uch article are redeemed within thirty (30) day at the pubticlln f hi ntice Nmf Pern: wndrea Walker Nian Mtr cceptance Crp Decriptin f rtcle: 2005 Nan llima N# 1N4L11085C218735 muntl Lin: $745405 Publhed in Pineer Pre 4(16 4P3 413W09 (1683723) C PUBLC LEN SLE That n 5/26t2009 a aie will be held at 3:00 pm al: Grand ut & Truck Center 2427 W Gland ve Chcag L 60612 ll bid t be in wril ng t ell lli fllwing rti cl t entrc u lin exlliag under the law 01 he Stale f llini againt uch article lar gbr ervice kill r material expended upn r trage turnihd fr uch rtide al he requet f the fllwing dignated pern() unle uch arlicle re e deemed within thirty (SO} day f the publicatin f thi nlice NME OF PERSON(S) udrey F Byrd Capital One ul Finance DESCRPTON OF RTCLE 2004 Cadllac CTS 1G6DM57794019060S MOUNT: $882137 NME OF PERSON(S) Lrraine Hawkn Tyta Mtr Credil Crp DESCRPTON OF RTCLE 2006 Tyala Crlla 1 NXBR32E86Z7541 10 MOUNT: $733768 Publihed n Pineer Pre t/t6 W3 k30/09 (1683689)C4 PUBLCLEN SLE That n 5220O9 a al wll be hld al 3:00 pm al: Park One nc 7U S Plymuth Caur Chicag L 60605 l bid t be n wrillng ell the fllwing arlicl t entrce lin extng under the lw f the State el llini gainl uch article fer labar ervce kill r malerial expended upen r trage furnihed fr uch article al lh rquel f h fllwing degnated pern() unle uch article are redeemed within thirty (30) day el h publicalin f thi ntice NME OF PERSON(S) Lukaz Twrek Luke 7wrk BMW Bank f Nrth merica DESCRPTON OF RTCLE 2003 BMW 330i WBE53403KMO2920 MOUNT: $561000 Publhed in Pineer Pre 4/16 4/23 43W09 U684883) C2 Buying r Selling Pineer Claified i the place fr yul (847) 99834OO 1046 Lien PUBLC LEN SLE That n W2009 a ale will be held at 3:00 pm at: Phillip TOwing 1168 N Hited Chcag L 60622 l bid t be in writng t ell the fllw ng article t enfrce a ln exillng under the law f the Stat f llni againt uch article fr lber ervce kll r malerial expended upn r trage furnhed fr uch artcle at he requet f he fllwing delgnaled pern pern() unle uch rlicl are redeemed within thirty (30) day f the publicall f thi alice NME OF PERSON(S) Jam J Thma DESCRPTON OF RTCLE 1993 Kl Spha KNFB1214W5750896 MOUNT: $097000 NME OF PERSON(S) Til Fni DESCRPTON OF RTCLE 2000 Lexu E5300 JT8BF2GGYSO9628 MOUNT: $197000 Publihed in Pineer Pre 431w09 (1687700) C2 PUBLC LEN SLE That n 6/1/2009 te wilt be held al 300 pm at: Schumburg Mtr Wrk 43$ W Wie Rad Schaumburg L 60193 li bid be in wrillng e)) the fllwing rticl enfrce a lien exiting under the law f the Slate f llini againt uch article fr taber ervice kill r mlerial expended upen r trage furnihed fr uch article al flic requet f (he fllwing deignated pern() unle uch article are redeemed withn thirty (30) day f the publicalin f hi ntice NME OF PERSON(S) Jutin Sctt Prp) Juln Prpt DESCRPTON OF RTCLE 1994 Pntac Grand Prix i G2WJ12X6RF335950 MOUNT: $119500 Publihed in Pineer Pre 43Mw (1688083) C PUBLC LEN SLE Thai n W1r1009 ale will be hld at 3:00 pm al: Phillp Twing 1168 N Halted Chicag L 606fl ll bid l be n wrlling t ell the fllw ng article t enfrce a lin xiling under the law f the Slate f llini againt uch artcle fr labr ervice kill r material expended upn r trage furnihed fr uch article al he requel t he fllwing delgnaled pern() unle uch rticie ar redeemed within hrty (30) day f the publicallan f hi ntice NMEOF PERSON(S) Hnel be ul Sl DESCRPTON OP RTCLE 2000 GMC Jmmy 1Gl(DT13W6t2)97811 MOUNT: $197000 Publhed in Pineer Pre 3W09 (1688077) C Buying r Selling Pineer Claified i the place fr yul (847) 9983400 1062 Prbate STTE OF LLNOS N THE CRCUT COURT OF COOK COUNTY LLNOS PROBTE DSON n the matterf the tat f JOSEPH L COLUCC K GUSEPPE L COLUCC (Deceaed) Cae N 209P 001013 PUBLCTON NOTCE Nllce hereby given r ihe death f JOSEPH L COLUCC K GUSEPPE L COLUCC f Chicag ) i Leter f ffice wre iued n February 13 2009 TO F COLUCC whe al rney i NCENT SNSONETT 5521 Nrth Cumberland venue #1109 Chicag L 6&i556 713 775 2626 Claim againt the etate may be tiled n the ttica t the Clerk f the Circuit Curt n Rm 1202 Richard 1 Daley Cantar Chcag llini 60W2 r wilh th repreentalve r blh n r befre Oc lber 16 2009 which dala i nt le than 6 mnth frm the dale at the firt publicaln f thi nlice and any claim nt filed wthn that pri barrd Cpie f any claim tiled With Die Clerk mu be mailed r delivered t the repreanlafiva and t he attrney Withn 10 day atter it ha been tiled /5/ incent Snnelti (ttrney) Publined in Pineer Pre 416 4)23 4/35019 (1685391) C STTE OF LLNOS N THE CRCUT COURT OF COOK COUNTY LLNOS PROBTE DSON n the mattert he etala f ELZBETH PECORELL Deceaed Ce N 09 P 859 PUBLCTON NOTCE Ntice i hrby given f he dlh f ELZBETH PECORELL f DES PLNES LLNOS Ltr f ffice were iued n March 27 2009 t LWRENCE PECORELL 20)9 Glenview Rd Glenview L 60025 whe attrney i TRCE? L NHEM 554 Sheridan SQ #1 Evantn L 60202 847 8666137 Clam againt the elale may be filed iii hn ttc f the Clerk f h Circuit Curt in Rm 1202 Richard J Daley Center Chicag llini 60602 r with the repranllive r bth n r befre Oclber 16 2009 which dale i nt le han 6 mnth frm te data at the firt publicalin f hi nlic and any claim nt tiled withn that priad barrad Cpe f any clnim tiled with the Clark mut be malied r delvered l t repreentativ and l the attrney within to day attr lt i tiled //Trcy L Nihm (ttrney) Publihed in Pinner Pre 4/16 4/23 4r3)W9 (16841081 C 1066 Public Ntice PUBLC NOTCE Ntice i hrby given by the Bard f Educatin Slcakie Schl Dilricl 73_5 Cunty et Ck Stla f llini tha a public (tearng regarding a wiver/mditiclin ha chl cde requiretnenl al tudent/lat alfendance n legal chl hlday will be hld n May 12 2009 7:110 pm: at McCracken Middle Schl 8000 Eat Prairie Rd Skkie L 60076 Tetimny will be taken frm educatr and the public Dted th pril 242009 Bard f Educatin Skkie Schl Dirct 735 ndrea Ren Secretary Publihed in Pineer Pra 41:10 5/7/f9(t688694)C 1066 Publc Ntice wwwpiriêerlcalcm La1 Ntice TCutmert lln mercan Water Cmpany (WC WC hereby give alice t the public 1h01 nfrmatn hn cmpany ha fled with the llini Cmmerce Crnmin prped tnt page fr a Qualfyng ntralructur Plant Surclurg (Q1PS) fr the Champaign Sterling Pekin Lncln Suth Blit and Chicag Mire ervic ditrict The GPS Rider wuld implemanl charge (r watar and watewatar ervice t cver return n and return f he cpilal cni related t replacement r rehabilitatin et nnrevenue prducing plant titratruclure uch replacement main meter meter ntaltalin ervice and bydranl The GPS Rider wuld be expreed a a percenlage nt t exceed 5% and wuld be applied l the amunt billed each cutmer undar the therwe applicab rle Ond charge excluiv f purchaed water and watewater treatment urcharge The QPS Rider indude an annual trueup prviin enure that revenue cllecled under the QPS Ridr are equal t tu actual ct incurred ntereted partie may blin in(rmalln with repect theret either directly tram WC r by addreing hn Chief Clerk f the Cmmiin 527 E Capitl venue Springfield L 62701 Publihed in Pineer Pre 430 $17/09 (1688977) C L LEGL NOTCE Ntice Hereby Given The Bard Of Educatin Of Schl Dtrict N 74 n The Cunty Of Ck Slate Of llini That n mended Budget Fr Sld Schl Ditrict Fr The Fical Year BeginnlngJuly 1 2008 nd Ending Jun 30 2009 Will Be On Fil nd Cnvanlenlly vailable Fr Public npectn n The Office Of The Bard Of Educatin 6950 Eat Prairie Rad Linclnwd llini Frm 8:00 M T 3:30 PM Mnday Thru Friday On nd fter The 4th Of May 2009 Ntice Furlher Hereby Gven Tha Public Hearing W1Ba Held t 7:30 PM On The 2nd Dy Of Jun 2009 n The Chamber Of The illage Hail Of Linclnwd 6900 Nrlh Linctn venue Llnclnwd llin Dated Thi pril 30th 2009 Bard Of Educatn Schl Diric N 74 David Kader Secrelary Publihed in Pineer Pre 43WD9 (168879tiC Legal Ntice T Culmer at llin mercan Waler Cmpany Puruant t the CC rder iued in Dcket 050681 (cn) n pril 17 2009 the cmpany flied revied tarilt ht will prvide n unitied el f rule regulatin and cndilin at ervice fr ali culmer n llini cpy f the cmpany tiled ritt may be in pected by any ntereted party al th cmpany lcal buineltice nteretad partie may intervene n any CC prceed ng cnidering revied lariff puruant t 83 lii dm Cd 200 Publihed n Pineer Pre 430 W7109 (1608497) C NOTCE OF RESED BORD OF TRUSTEES MEETNG CLENDR Ntice i hereby given by the Bard f Trutee f Crnmutly Cllege Dilrlct H 535 Cunty f Ck and Slate at llin cmmnly knwn a OKTON COMMUNrY COLLEGE that h elablihed calendar f meeting f the Bard f Trutee ha O66 Public Ntice been revied t nclude an dditinal meeting l declare he reull f the pril 7 2009 cnltdted electin and l rerganize the fficer f te BarcL The additinal meeting will be held n Tueday May 5 2009 beginning at 5:00 pm in 111e Bard Rm (1506) at Oktn Cmmunity Cllege 1600 E Glf Rd De Plaine llini: Datedat De Ptlne llini thi 22nd day f pril 2009 Emry W William Chr Bard f Trutee Oktn Cmmunity Cllege Dltrlcl 535 Publihed in Pineer Pre 4O9 (16884841 NC PUBLC NOTCE Public nlica i hereby given tiai the Nrwad Prk Fire Prtectin Dilrici Bard f Fire Cmmiiner ha revied the Rul and Regulalin cpy f ba Revied Rule and Regulatin f the Bard at Fire Cmmiiner will be avuable fr public npeclin frm and after pril 20 2009 trm 8:00M 4:00PM weekday al the Ditrict ttica al 7447 W Lawrence Harwd Height L 60706 Publihed by authrity and directin at the Bard at Fire Cmmiiner f hn Nrwd Park Fire Prtctien Dilrict Publihed in Pineer Pre 4/39 (16117777) C Tim Lw Ottica f Shari Shelmdin 53 W Jackn Blvd Suite 1209 Chicag llini 60604 Stale at llini Cunly f Ck n h Circut Curt f Ck Cunty Department Chancery Diviin Funder nurance Cmpany y Lillian R el al N0O8CH2J8S3 Nllce i hereby given t yu drealn Bibb Detndnl in the abve enlililed ull hal um aid ull lia been cmmenced in le Circuit Cur) t Cl Cunty Chancery Diviin bylh aid ptainlltf againf yu and ther delndant praying hal the Curt datermine and adludicate the right and repnlbilite t he variu partie in and t Funder nurance Campany Plicy #L1L045326 wilh repect t the ccurrence f Nvember to 2007 Ntice al hereby given yu hat aid Cmplaint pray fr ther relief; that ummn wa duly iued ut f aid Curt againt yu a prvided by law and tha the ld uit nw pending Therefre unle yu dreain Blbb fila yur anwr the Cmplainl in the aid uit r therwe niake yur appearance therein in 111e lfice f the Clerk et hn Circuit Curt (f Ck Cunty Chancery diviin Rm 802 Richard J Daley Center 50 Wet Wahingtn S in h City f Chicag L n r befra May 26 2009 default may be enterad againt yu at any time alir thl day and a Judgement entered in ccrdnce wilt hn prayer f aid Cmplaint Publihed in Pineer Pre 4/30 5/7 5/14/09(1686833) C2 The Lw Otl et Shari Shlmadln 53 W Jackn Blvd Suite 1209 Chicag llini 60604 Slate et llini Cunty f Ck n the Circuit Curt f Ck Cunty Dpartmenl Chancery Diviin Funder inurance Cmpany y Emily Read el al N 0$ CH 37783 Nlce i hereby given yu Emily Reed Defendant in the abve jilililed ull ba) he aid uit lia been cmmenced ir the Circuit Curt at Ck Cunty Chancery Diviin bylhe aid Piinlltf galnf yu and ther dlandani praying ta the Curt determine and adludicate the right and rapnlblille f 1066 Public Ntice the vru parte n and i Funder nurance Crneany Plicy #FCLJ36SO7 with rpeci t the ccurrence t March2 2000 Ntice i al hereby given t yu that aid Crnptint pray tr ther relief; that ummn wa duly iued ut f aid Curt againt yu a prvided by law and that fha aid uit i nw pending Therefre unle yu Emi 1v Reed file yur anwer t the Cmplaint in the aid ull r therwie tke yur appearance theren n the ttic f the Clark f the Circull Curt f Ck Cunty Chancery diviin Rm 802 Rlchard J Daley Cnter SO Wet Walingln St n the City f Chicag L n r be (re May 18 2009 dfull may be entered againt yu al ny lime tler tha day and a Judgamrit entered in ccrdance wilh ba prayer f aid Cmplinl Publihed in Pineer Pre 4116 4/23 4/309U683467) C2 Sld by Pineer Claified lakait leur ile (lieecakc Baklava iilt lelegra tiri fleelive Urn Liiiri X rtitair Îl itrikrat St rller Cal 55 /r;utt llar li (er;iiiiie ligr Slirg 950 Jiikbux birn ii uber \li j t u l$arin:r lilt tl Sitik l5laver trtii (uuekriki ut (?uua rl :rlirrie Elviri Puekv l)eeatuter lt/bl Sluuuleluaker Oriental Llelultlte tluet i 501) lb Criaille \nx 4 Kuuig {ieluard Sterling Flatware Jg Split terri 2neway ticket t Lu ega Fretin Ca uuulelrulura l3uuuuulay Chet Si eniler lruunk (O Life Migaziuue )26 l)dg 1935 ltiri X\ Sleiuuay (; rauuul t Li ui> Etighilu Juuuuujuitug Srululle Peruuiatu c;uuituuuu >jg _ituky l)iuug Nucklae Ruiniruuu Bra Sa ui uvrir (u t turl1 ( :tll1 ui luuug \luii ul ink Suarf Fnnrli gituu> tif uuir iluulrul t " Kit uluiuug Oruhuut ra lien Clii it Jrari lueurie ltuuruutr M uge lrubli lilly fleer Cauflrabri litt iu frt Etuglauul Key lung frt Eatern Steri nuuiuip Liu We Deliver Reult! 8479983400 Pineer Pre Publicatin (x) 1066 Publc Ntice 1066 Publiç Ntice Buying r Selling Pineer Claified i the place fr yu! Buying r Selling Pineer Claified the place fr yu! (847) (847) 9983400 9983400 Public Ntice Rul at the Skkie Lcai Liqur Cmmiiner pplicatin Prcedure t Cla Licene 1 Cla E Licene and t Cla O Licene Effective pril 302009 E1 Nrlh Cmmercial Liqur Ditricl O2 Office Reearch Zning Dtrict Publih Nlice: pril 30 2009 pplicatin Perid: May 1 2009 thru May 14 2009 Prped uance Dat: May 18 2009 Lllery Date: May 15 2009 (il neceary) pplicatin Prcedure fr; Cla Cla E1 Licene n ihn Hrt) Cmmercial Liqur Ditricl and Cla O2 Licene in the Office Reearch Zning Dtrict Effective pril 30 2009 li Nlice at appllcafln prcedure regarding the abve liqur licene effective pril 30 2009 prmulgated by he Skkie Lcal Llciur Cmmiiner (hereinafter SLLC) will be publihed in tre Skkie Review n pril 30 2009 2) pplicatn fr the abve Licene will be available fr pickup al illage lll n the Office f the Mayr beginnn pril 30 2009 The SLLC will be accepting appltcalin cmmencing May 1 2009 hrugh May 14 2009 f tter reviewing he cmplald applicatin the SLLC find that there are mr qualified applicanl ban l available lcene a latey wlil be held r May 18 2009 Shuld a tllen be neceary the SLLC wll dltribul prcedure regarding the pending lllry t tue quali(ied applicant The applicanl will be ntified by the SLLC by phne and via Firt Cla Mail by May 15 2009 t after reviewing the applicalin il i determined tha there are n qualified applicant then the SLLC hall again pen hn applicatin perid n a lirt cni tirt erve bai unlil uch tme a the available licene re ued 3) quclilied applicant hall be dtlned n part a ar applicant wilt an etablhment already in peratn OR ne that can prduce dcumentatin demntrating an etblihment will be peraling n later than 12 mnth ubequent t hn awarding f a liqur licene lt a licene awarded and i etablihmenl de nel pn wilhin le 12 mih perid the licene will be frfeted and reiued t anther applicant n additin le uance f lcn at 1er ibeen awarded i ublecl f le applicant and hn elhlihmnt lcalin being in cmpliance with any and il ther applicable lcal rdinance and law f hn Stat f lln t) n rder t be eligible tr afrementined licene it mut meet any and alt requirement al ut in Sachan 10 64 f le Skkie illage Cde pplicatin tr h licene huld pecify fr elllier a full licene r a Enei 8 Wie Licene PLESE TKE NOTE Cla E licene r nly valid fr the addre tr whch ly are ued and may nt be mved l a new lcaln even wilhin the rn Cmmercial ditricl Upn award al a licene paymenl n the amunt at $10000 r $4500 mut be mde t he illage wittuin 8 hur Pc cntact Sunny Dane in tie Crpralin Cunel Ottica at (847) 9338270 lar urlher inlarinaliu "Ti rule ued by te Skkie Lcal Liqur Cmmiiner lriclly ter ba applicatin prcedure tr the u ancet the Cla Cla Ei and ClaS O2 Licene etfectie pril 30 2009 T review hn Skekie illage Cde pleae acce ur webita al wwwkkigrg r call the Crpratin Cunel Ottica tr a cpy f tre requeted ectin //Gerge n Dueru Skkie Lcal Liqur Cmmiiner Dale: pril 30 2009 Publiled in Pineer Pre 413409 (1689006) C pineer Pre Publicatin (Dc) pineer Pre Claified ut Dealer Directry OB RORMNS RLNGTON CUR N PLTNE 1276W DUNDEE RO PLTNO ruar WEST OF Ri 53 ON DUN000 (847) 9909000 JOE nzz CUP 2OBPWEST 159Th STREET OmND PFK 7O84O31770 invcafs00m MULLERS W000FELO CUR 1099 WEST HGONS ROD Firi MN ESTTES L 3475199550 MrJLLLFFCFFSC0M PULY CUR 26119 SKOKE LLEY ROD HGHLND PRK L B474338200 JCUF COM UD THE UO EXCHNGE 2490 SKOF<E LLEY RD HGHLND PRK (B47) 4325020 J SL XC HNGE COM " STEE FOLEY BENTLEY 100 SKOKE BLD JORTHBROOK (847) 5644090 Sn t OLÇXCGM U" T JFNTXYSZJFR BM$ BLL JCOBS BMW 1564 W OGDEN E NPSRLLE (866) 5168015 rs JCOFXUMW COM ELMURST BMW 4GGWEST LKE STREET ELMHURST (BBS) 2876555 L t ifsustomw cw KNUZ BMW KNUZ UTOPR( RuiE 41 @ RT 176 LK BLUFF 847} 6045000 SNLJ COL PTRCK BMW 700 EST GLF RD SOFUMOURO L 60173 tbgg) 6526124 \FCKCSMWCOM GROSSNGER BUCK 6900 N MCCORMCK BLD JNCOLNW000 (856) 6701654 JJNGUFSLSUCKCOM KNUZ BUCK NUZ UTOPRK bull 41 @ RT 1713 LKE lii ii 1847) 2342800 rs rom RZZ BUCK 8425 WST 159TH STREET r F YPSK 1708) 4296000 S1/CSCOM la4 al 0 me 011tnal eqjilmeni wfl etra 2009 Prche Car Nrth )Frrrrca tc Fr;ch recmfllend eat belt uage and Obervatin ut all tais; cdft ET1LESON CDLLCBUCK PONTCGMC 6150 S LäRNGE RD H0000KNS 1708) 5795000 ETTLESON00M GROSSNGER CDLLC 6900 N MCCORMCK BLD LJNJCOLN WOOD (866) 6701654 GROOSNGEPCOLLCCOM HERTGE CDLLC 303 WEST ROOSEELT RD L0MuRD f6301 6293300 HE RTO E COL LC CO M PTRCK CDLLC 526 ML DRl SOtUMaURG L 60173 666) 6142277 FTCK C D LL C COM RZZ CDLLC 8425 WEST 159TH STREET TNLEY PRK (708) 4296000 R 5ZZC n S 0 O M t BLL STSEK CHEROLET 700 W DUNDEE RD W EELNO CORNl 01 DUNDEE to NO) 03 (847) 5377000 S1SEKCLOLCTCDM BREDEMNN CHEROL 1401 W DEMPS1EP PRK RDGE L (847) 6981234 OREDLMNN C0M CLSSC CHEROLET 425 N GREENPY RO WUKEON L 847CLjUrcM CLSSCDCL Si78 Cler t heaven but further frm the cmpetitin ipjti 4) w 1) ph 5 THE EXCNGE (847) 2667000 2300 Skkie alley Rd Highland Païi L 60035 www4prctiecm Hur M Th 9M 8PM Fri 9M 6PM Sa 9M 5PM wwwpineerlcalcm GROSSNGERCHEROLET 151 E LKE COOK ROD PL11NE 1800) 3597700 0nriNGE5Ci1EYM JENNNGS CHEROLET 241 WUKEGN RD GLENEW (847) 7291000 JENNtNGC11L101TCOM RYCHEROLET 39 (1 U S HGHWY 12 FOX LKE L 60020 (847) 5873300 W5WnC5EPOt EXCOM RYMOND CHEROLET 11BWROLflE 173 NTOCO L 60002 (847) 3953600 wwwlymnc1e110tt)m RZZ CHEY B200SOU HRtEM EUE B RDO E E W (7081 5946400 flzzc15cst SHEPRD CHEROLET ND MEDUM DUTY TRUCK CENTER RTE 43 T lte 176 LKE BLUF (8471 2347900 DuPGE DODGE CHRYSLER JEEP B EST RaEvLr OF 365) (ONLY 3 MLES WEST (866) 3880387 urûujlr COri GREGORY CHRYSLER JEEP 18836 WEST GitNO E GUNFE (800) 7706582 GlL G)Yt)005105 c0m LBERT" UTO CTY CHRYSLER 1000 E /SK E JDE5TYLLE (866) 4744313 ElGE lys0m L 151E 55E r ) u 4 DuPGE DODGE CHRYSLER JEEP BOO EST ROOSEELT 1ONLY 3 MLES WEST OF 355) t8661 3880387 OUPGE L5PCOM GURNEEDODGE 725GGRNDE l enlia wet f Gumb Mill) 847) 6233000 GURNELDODGECOM LBERTY UTO CTY DOGE 1000 E PRK E L 53E RTYLLE (866) 4744313 LnE r S) E0CTCOM HGHLND PRK FORD/ LNCOLN MERCURY 1333PSKEWEST HGHLND PRK L (847) 4337200 (FF1 M COM JOE RZZ FORD LNCOLN MERCURY 2100 SOUth HRLEM ENUE NDU1( toe1ssde (1008) 4427000 1112 LC S S COM LT:: GROSSNGER GMC (3900 N MCCO5SMCK BLD LNCOLN WOOD (866) 6701654 GOSSNGLnGMCCDM fond : MULLER HOND 550 SKOKE LLEY ROD HGHNO PRK L (847) 8314200 MU LE HCSSSCOM OHRE HOND 1533 BuyER RD DES PNES L (888) 7501134 wwwoi5re50ndm ThE HOND SUPERSTORE OF USLE REF 53 1 BLK S OF l88 1EMF Tliway) t630 8527200 WWWTHE HON DSU SCR STO R E COM PULY HOND 1 1 1 1 SOUTH MLUKEE E L3EFOrSLLE (847) 3624300 WQWFULHDNDCOM HYUND GREGORY 4YUND 490 SKOKS LLEY RD HGHLND PRK (800) 7706578 OS5EGOflUT0Dfl01COLl GROSSNGER 1UND 6747 N LiNCOLN ENUE LNCOLNWOOD (866)6487442 O(SJSSNGSSYUNU500M GURNEE HYUND 6261 GuNO E O5FOSiTE GUSNEE MLLS (84712491300 OUUNL5 SYNDCOM KNUZ HUNO ROUTE 41 @RT 175 LKE BLUFF (847) 2342800 (J NUZ COM Thurday pril 30 2009 u_ HYUNØ LOREN HYUND 1620 WUKEGN ROD GLEN1EW (847) 7290300 LORENUTOOSOUPCOM OHRE HUND 1509 RER RO DES PLNES L (888) 4867151 WWWOHREiYJNDwCOM PTRCK HYUND 1020 E GOLF RD SCHUMBURG (847) 5199600 WWPRCKCRSC0M RZZ HUMMER 8425 WEST 169m STREET TNES? PHl< (708) 4296000 n ZZCRS C O M FELDS NFNT i 121 5 MLWUKEE E LBE RTYLLE (847) 3629200 FE LOSUTO C O M FELDS NFNT GLENCOE TOWER RD & 94 GLENCOE (866 4355110 CDUTOCOM NFNm OF HOFFMN ESTTES Mtr Wrk Cmpar? 1075W GOLF ROD HOFFMN ESTTES (888) 8232498 u NFNTHOEFMN CON NFNTi OF USLE RTt53 1BLKSOF188 1ENT0wO i (630) 241000 euitilelnflnltlsu5erst0rec0 JGUÄR: HOWRD ORLOFF JGUR (ENNEDY EXP T RMTGE (888) 5100669 01110F FCOM JGUR ELMHURST 466 WEST LKE STREET ELMHURST (888) 2876211 JOUSSEMUflSTCOM PTRCK JGUR 1559 OGDEN E Napivill L 60540 (866) 8619716 5T fl C 5< J G US C0M DUPGE DODGE CHRYSLERJEEP BOO EST ROOSEELT (ONLY 3 MLES WEST OF 355) (BUB) 3880387 UUGLJCCOM GREGORY C4RS1ER JEEP 18836 WEST GuSNO E G U FNE E (800) 7706582 GLGC5UOOSOU COM LBERTY UTO CTY/JEEP 1000 E PPJSK LJeeSOrLLE f866) 474433 1(155(SYU5OC EY00M

Other B Thurday pril 30 2009 Pineer Prè Caîlkd ut Dealer Directry T*:v BREDEMNN LEXUS 2000 N WUKE3N RD GLtviw (847) 7296000 JnrOLMNN COM MC GRTH LEXUS OF CHCGO 12S0 W Oivtri (800) NEWLEXUS WWWMCGnTHLEXUSCOM MC GRTH LEXUS OF WESTMONT 470 E OGDEN t (800) NEWLEXUS WWWMCGUTLEXUSCOM LEXUS OF HJGHLND PRK 3040 SKOKE LLEY ROD HGiLND PRK (847) 4321900 L EXUSUTOSCOM LEXUS OF ORLND 8300 W 159TH Sr (708) 3426475 WWWLEXUSOÇQFLNDCQ OB RO$RMNS RLNGTON LEXUS N PLTNE 1285W DUNDEE flod PLTiNE (JUSTWEST r nr 53 r DUNDEE) (847)9910444 JNØR LNDROER OF CHC4GO T HOWRD ORLOFF KENNEDY E)(P T RMJTGE (888)5100669 O H L QL F CO M LNDROER OF HNSOLE 300 E OcçN E HNi (866)5168045 TuNS D LE L N Ti TO E TS COM LNDROER HOFFMN ESTTES 1051 W HGGNS ROD HOFFMN ESTTES (866) 5168035 LND SO E 11110F FM N COM LNDROER LKE BLUFF KNUZ UTO PRK Ruii i r 176 LKE BLUFF (847) 6048100 N UZ C O M PTRCK LNDROER OF NPER LLE 1559 WEST OGDEN E NPER LLE (630)3005000 LNDOE10FNELLCCOM HGHLND PRK FORD/ LNCOLN MERCURY 1333 PRÇ E WEST HGHLND P4HN (847)8315880 PLMCOM JOE RZZ LNCOLN/MERCURY 2055 WEST OGDEN ENUE NPERLLE (630) 3558140 ZZCTSCOM NPLETON LiNCOLN/MERCURY 826 TOURY E PRK RDGE (800) 9316583 PRKFDOCLNCOLNMEnCUS\CDM MZRÄ THE UTOE3RN MZD OF COUNTRSDE LaGRNGE 5700 LGRNGE RD (708) 3542700 MZEJGUYSCQM BGGERS MZD 1320 E CHCGO ST ELGN (866) 9MCHWE TlE MZD MCHNE ON lt 19 H100EHSMZDCOM»" New 2009 Mitéubj Outlander l 000 Pactry Rebaté $500 Owner Lyalty Rebat Milìta)y Febate LBERTY UTO CTY/ MZD 1000E PRK E L1BETErLLE (866) 4744313 LLTEU EOC1l COM MULLER MZD 150 SK0RE ELLE? ROD HGHLND PRK L (847) 8314100 MULLECSCQM ûr(j: UTOUS ON EDENS MERCEDES BENZ 1600 FRONTGE R NORTHUROOK (800) 7166405 hi OUEONEDLNSCOM KNUZ MERCEDES BENZ KNUZ UTOPRK RT 41 @ Rr 176 LKE BLUFF (847( 2341700 KNUCOM LOEBER MOTORS LOESETMOT011SCOM 4255 W Tjiuy E LJNCOLNu&100 (847) 6751000 MN: BLL JCOBS MN 1664W Odnvø (866) 5168015 DLLJCOHSMNCOM KNUZ MN KNUZ UTOPft( ROUTE 41 @ RT 176 Lu BLUFF (847) 6045050 KNUZCOM PTRCK MN 700 ET GOLF RD ScHUMF3URG L 60173 (866) 3706567 l rlllcxmjn1cm a MTSUBi LBERTY LLE MTSUBSH 1 19 S MLWUKEE LE LJSCF1T%L (847) 8166660 LBEFTYL LEM1SUJSFFCDM NPLETON MTSUBSH 826 TOUFY E PRK RDGE (BOO) 9316583 N PLE TO N COM eñ Mitubhi 0% fr 60 mnth avaflable n new 2009 Miubhi OuUander and new 2009 Mitubihi Lancer wh quaied credit PR ffer expire 4/30/2009 $1000 Factry Rebate available n new 2009 M/tub(hj Outlander with qualf credt $1500 Factry Rebate avaíabn n nev 2009 Mitubihi Lancer with qualified crdit $500 Owner Lyatly and $500 Mlitary Rebate available n bth new2009 vehicle with qualfied credit THE UTORN NSSN OF ENSTON 1001 CC13O E (847) 4758200 1 FEUTOJT/THNCDM BOB ROHRMNS RLNGTON NSSN _ws SPEK laur LNGUGE" 915 WEST DUNDEE ROD BUFFLO GROE (847) 5906100 HOTMNCOM LBERTY NSSN 920 3 MLWUKEE LE LTERTYTL E (866) 3292296 LUETYU10LZCO MRTN NSSN 5240 GOLE ROD SKOKE (266) 7990300 NORTH SHORE NSSN RE41 &PFK E WFSr H0LNTi PN (847) 4337900 WWWNOTTS0TECRSCGM PN!riÄ) GROSSNGER PONTC 6900 N MCCORMCK BLD LNCOLN WOOD (866) 6701664 GFOSSNOEPONTCCOM MULLER PONTC 1 50 SKOKE LLEY ROD HGHLND PRK L (847) 8314100 ETULLETC1S COM SULLN PONTiC 777 W DUNDEE ROD RLNGTON HEDTES L (847) 3926660 SLLS ULL N COM PORSCH LOEBER MOTORS PORSCHE 7101 N LNCOLN ESOUTF OF TOUF Y LNCOLNW000 (847) 6751000 LOEJEFMOTOHSCOM JOE RZZ PORSCHE 8130w 1f59iH STREET ORLNO PRK (708) 3642400 llu2cltscm wwwpineerlcalcm Chicag Larget Service Center Prud t be in the Chicag/and area ince 1931 826 T6uhy ve Park Ridge L 8007948046 PORSCHE EXCHNGE PORSCHE PREMER DELER 2300 SKOKE LLEY RD HGHLND PRK (847) 2667000 MOTOR WERKS BRRNGTON & DUNDEE R BRRNGTON (866) 2696275 MOFO1WEKSCOM ROLL STEE FOLEY ROLLSFnOYCE 100 SKOKE BEO NOR FHGROO< (847) 5644090 STE F DLY0 0M LLNOS L0ES ROLLSllyd DEl El SW11 SB EXCHNGE 1 SHERWOOD TERRCE LKE BLUFF (866) 924lili BO4OWUKEONRD MORTON GROE (847) 9679040 S1CXCN0ECOM PTRCK SB F26 Mu DFTFE SO(UMF3URO (888) 3501599 ltcksm COM RZZ SB 8425 WEST 1 S9ri STREET TNLEY PRK (708) 4296000 SCON BREDEMNN SCON 1301 W DEMPSTEFF PRK RDGE (847) 6983700 WWWRflFDEMNNÇO CLSSC SCON 425 N GREEDY R WUKEGN (888) 3000958 CLS;CD C COM CONTNENTL SCON 9960 JOUET ROD COUNTRYSDE (708) 3545800 CONTNN( MUOSCOM FOX LKE SCON 75SRTE12 FOXLKE (847) 4979147 10X1 KE;CONCOM (TSUB(SH( MOTORS NORTHBROOK SCON 1530 FRONrGE ROD NORrEFOROOK (800) 7439594 WWWNOSUUOKSCONCOM PUL SCON ON Rnr 14 CRYSTL LKE (815) 45971yj (847) 6589050 SMR mart center LKE 8LUFF KNUZ UTOP4Rg ROUTE 41 & ROUTE 176 LKE BLUFF (847) 2342800 KN US C O M UTOBRN SUBRU OF COUNTRYSDE/ LaGRNGE 6191 JOUET RD (Onv 15 nntj DOMiEyM1 0*5190) (708) 3546600 i FFCUTO3NCOM ENSTON SUBRU 7 1 5 CFFG E ENSTON (888) 4731605 L N STONSU lllfu0 DM LBERTY UTO CTY/ SUBRU 1 000 6 PnC E LDERFYNLE (866) 4744313 LLLÇYUEOC COM SUZuK1 GROSSNGER SUZUK 6900 N MCCORMCK BLD LNCOLN WOOD (866) 6701654 GOSSNOESUZCOM LBERTY UTO CTY SUZUK 1000 E PTK Uunvviijc (866) 4744313 LTEFUTOC TYCOM Pineer Pre Publicatin (Dc) TOYOT BREDEMNN TOYOT : i w DEMPSTER PRK RDGE (847) 698"3700 3FEDEMNNCOM CLSSC TOYOT 515 N OREtNBY RO WUKEGN L FOX LKETOOT FOFTME1TLY Ertri TOYOT" 75 S Rn12 Fx LKE (847) 4979147 FOXLKETOYOTCDM GROSSNGER TOYOT NORTH 7225 N CCERO LNCONWOOD (866)6126679 GROSSNGENTOYOTNORTCOM GROSSNGER CTY TOYOT 1233 N WELLS ST CHCG (800)8739315 OOSSNOEFCmOYOT COM LBERTYLLE TOYOT 1 180 Simu MLWUKEE E L3ERTYLLE (847) 3621500 LLE1TLLETOYOTCOM PUL? TOYOT 1035 S RT 31 ONE MLE SOUTH GP RT 14 (815) 4597100 (847) 658 9050 NORTHBROOK TOYOT 1530 FROSTGE ROD NORTHETROOK L 60062 (800) 7439594 WWWN 01111 D T DOK QYOT COM OKBROO( TOYOT! SCON N WESTMONT 550 E OGDEN ENUE (630) 7899600 OTTLROOKTOYOTCOM ORLNO TOYOT/ SCON 8505 W 169m ST TNLEY PRK (730) 4293900 ORLNDSCONCOM OEK$ UTOBN OLKSWGEN OF COUNTRYSDE! LaGRNGE 6191 JOUET RD (0nF l5nnufrm (708) 3646600 1H E/lUTO lr N COM BLL JCOBS OLKSWGEN 2211 UROnve; Npuva (866) 5168025 DLUCOTSWCOM NORTHSHORE OLKSWGEN RrE 41 & PRK E WEST HGHLND RK (847) 4337900 WWWNORTHSFTORECFSCOM OlkZlCJOt BRRNGTON OLO 300 N HOUGH (lt 59) BRRNGTON (847) 3819400 HOWRD 0810FF OLO KENNEDY Exp TJMTGE (888)5100669 OTLOFCOM PTRCK OLO 1600 E HGGNS RO SCHUMFURG L (847) 6054005 lrllckvolvcm OLO OP LSLE Miclwt LarflOt lv Suprtr RTE 53 1 B)k S f 88 (EMe TOLLWY) 630) 8526000 ww LLOLO$URSTOECOM ONEERPRESSPUBUCTON k wirelecarrier maytet OU make free call t peple n their netwrk but US Celuar ge a lt further We give yu Free ncming Callplu Free ncming Text and Pixfrm phne n any netwrk at any time including landline Switch t US Cellular and yu wnt ever have t wrry abut anwering ince everything headed yur way i free Swhy ettle fr free when yu can get freerfrm US Cellular? ;et a Natinal Plan r yu and yuràmuy u Ue ylt mifiute anywhere in the cuntry N rárnìngrngditancetharges 1 believe inmething better" wwwpineerlcalcm LG UX300 GETUP TO FE Ffter$50 mao)» rebale that cme a lia Debit Card Require new 2yr agntt and 3m Unlimited Data Plan $30 ac fee may apply vailable in Blue and Silver N cubnîpn WTH Ätcãtel Lucent Let u help yu find a catifl viit ucellularcm r call 1888BUYUSCC Thing we want yu t knew: New twayear agreement (ubject t early terminatin fee) and credit apprval required $30 acílvatin fee may apply Regulatry Ct Recvely Fee applie; thi i nt a tax r gvernmentrequired charge dditinal fee taxe term cnditin and cverage aiea apply and vary by plan elvice and phne Ue f eivice cntitute acceptance f the term f ur Cutmer Service greement See tre fr detail r viit iued by MetaBank puruant t a licene frm ia US nc llw 1012 week tr prceing Card de nt have cah acce and can be ued US Cellular ia Debit Card ucellularcm Prmtinal Phne ubject t change at any merchant lcatin that accept ia Debit Card Card valid fr 120 day after iued Uplirnited Data Plan tart at $995 ier mnth Premium Mbile nternet Plan i $1995 ier mnth pplicatin and data netwrk uage are the prperty f their repective wner 02009 US Cellular ffer Trademark and trade name charge may apply when acveing applicatin limitedtime 17

ieiaew wwwpneercalcm THURSDY PR 30 2009 Calendar Cntinued frm PGE 15 ter fr clae r trip r purchae ticket Drp by the NUe Senir Center 999 Civic Center Drive Nue r call (847) 5888420 Fr an applicatin Supprt dvcate Lutheran General Hpital ffer Sibenatin a prqram fr brther and iter Ç children with pecial need age 813 that fcue n wrking with healthy ibling f children with develpmental and phyical diabilitie Participant learn hw t handle ituatin and the implicatin f having a brther r iter with perial need thrugh craft and ther activitie including ageapprpriate dicuin Sibenatin i held nce a mnth during the chl year in the Yachtman Children Pavilin 675 Dempter St Park Ridge Rm YZ109 (ecnd flr) The next meeting i 911:30 am May 9 Ct i $10 fr each ein: $5 (r each additinal ternily member T regiter call Kathryn Smart at (847)7239484 r email nathrynsmart@advcatehealthcm Cathlic Charitie f the rchdicee f Chicag invite the wh have experienced the l f a lved ne t uicide t participate in it Lving Outreach t Survivr f Suicide prgram meeting 79 pm May JO at Cathlic Charitie Nrthwet Office 1717 Rand Rad De Plaine Call (847) 3762)10 Grandparent Cireiyr a prgram pnred by Children Hme+id will ffer grandparent an pprtunity t meet ther grandparent hare cncern and talk abut intereting tpic that will help them care fr their grandchildren Meeting are 1011:30 am the firt Wedneday f the mnth at Nue Public Library 6960 Oaktn St Free child care i available with 24hur ntice Meeting are mnthly Call Linda (847) 6409590 The Strke Club f dvcate Lutheran General Hpital meet frm 34:30 pm the firt Thurday f the mnth at the Outpatient Therapy Center Church and Ptter avenue De Plaine Call Megan Ptterfield (847) 7236690 Hlding Ont Hpe i a mnthly daytime grup br widwed peple grieving the l f a pue lt meet frm l2:30 pm the furth Wedneday f the mnth at Rainbw Hpice and Palliative Care 444 N Nrthwet Highway Suite 145 Parh Ridge Regitratin i required dmiin i S5 per ein Lfe Tranitin Grup i an nging upprt grup fr anyne wh a a general guideline ha been widwed fr ne t fur year meeting 78:30 pm the furth Tueday f the mnth at Rainbw Hpice and Palliative Care 444 N Nrthwet Highway Suite 145 Park Ridge The fee i $5 per ein Widwed Supprt Grip i an ngìng upprt grup that addree le faced by pern a a general guideline wh have been widwed le than tw year lt will meet at 7 pm n the ecnd and furth Tueday f the mnth at Rainbw Hpice and Palliative Care 444 N Nrthwet Highway Park Ridge Ct i $5 per ein Call (841) 6859900 Gd Nurninq Prgram will meet 6:458 pm every third Mnday f the mnth at Lutheran General Family Care Center 9375 Church St De Plaine The prgram i a up prt grup fr children teen and familie wh have lt a bved ne thrugh death Preliminary inter view i required befre regitratin T regiter call Rainbw Hpice and Palliative Care Bereavement Supprt (847) 6928884 Weight N Mre a friendly weightl upprt grup i welcrning new member Dicuin include weightl tip recipe cntet and helpful idea t help yu reach yur gal Meeting are 9:3010:15 am Friday at Hward Leiure Center 6676 Hward St Nue lwer level (elevatr acceible) Weighin are 9:159:30 am meeting frm 9:3010:15 am Ct i $5 per mnth Call (847) 679 4229 TR PD Chicag Treatment and Reearch dvancement ciatin fr Pernality Dirder hld a mnthly upprt grup fr peple with lved ne uffering frm brderline pernality dirder r emtinal diregulatin The meeting i at Ruh Nrth Shre 9600 Gr Pint Rad Skkie frm 6:308:30 pm the third Wedneday f the mnth Email rh5mailtara yahcm fr the rm number r mre infrmatin The Cunetin; Center f dvcate Medical Grup ffer a Free Healing Our Lt Dream (HOLD) upprt grup twice a mnth fr peple wh have experienced pregnancy and infant l Meeting are 78:30 pm the firt and third Tueday f each mnth at the Cuneling Center 1610 Luther Lane Park Ridge Parent grandparent and ther adult family member are invited t attend the ein hare their feeling with ther wh undertand what they are ging thrugh receive upprt a they mve thrugh the firt ean f grieving erve a reurce fr each ther and gain new perpeclive f life Call (847) 7953100 Crhn Ft Cliti Fundatin upprt grup meet frm 7:309:30 pm every third Thurday f the mnth at dvcate Lutheran General Hpital 1775 Dempter St Rm 1063 Park Ridge The fcu i t ait patient with Crhn dieae r ulcerative cliti their familie ignificant ther and friend in cping mre effectively with the illne Call (847) 8270404 Reurrectin Medical Center pnr a variety f free cancerupprt grup fr bth patient and their family member ll upprt grup are free and meet in the Cancer Cnference Rm (grund flr Entrance C) Cntact Carl Flanagan (773) 7925116: The Cancer Supprt Grup fr cancer patient familie and friend meet mnthly frm T8:30 pm every lat Wedneday The Leukemia & Lymphma Family Supprt Grup fr peple with leukemia lymphma myeldyplatic yndrme multiple myelma Hdgkin Dieae and their familie meet every firt Wedneday f the mnth The Butterfly Club i a upprt grup fr children age 6 t 13 whe parent r caretaker ha been diagned with cancer The grup meet every firt Wedneday f the mnth Regitratin and parental cnent are required The U T! Prtate Cancer Supprt Grup meet every ecnd Wedneday f the mnth The Teen Cancer Supprt Grup i fr teen age 13 t 18 whe parent r caretaker ha been diagned with cancer The grup meet every third Wedneday f the mnth Regitratin and parental cnent are required Multfple Scleri Supprt Grup meet the lat Saturday f each mnth in the eurrectin Rehabilitalin Center f Chicag firt flr Prfeinal Building Entrance C Call (773) 5947856 lzhelmer Supprt Grup meet the ecnd Tueday f the mnth in the Health Management Clarm The ein i free Call Health Management (773) 7925022 fterqlw Supprt Grup fr trke urvivr and their family and friend meet the ecnd Wedneday f the mnth in the Reurrectin Rehabilitatin Center f Chicag firt flr Prfeinal Building Entrance C Parkinn Sipprt Grup meet the third Wedneday f the mnth frm 57 pm at Reurrectin Rehabilitatin Ceter f Chicag firt flr Prfeinal Building Entrance C Call (773) 5947866 dvcate Lutheran General Hpital i frming a upprt netwrk fr wmen living with breat cancer The Breat Cancer Netwrking Grup will meet frm 23 pm the third Tueday f each mnth The upprt grup prvide breatcancer urvivr the pprtunity t hare infrmatin and experience with ther wmen The grup will be at Lutheran General Center fr dvanced Care 1700 Luther Lane Park Ridge in the grundflr cnlerence rm G104 Call (847) 723 8130 Familie nnymu i a free 12 tep elfhelp upprt prgram fr family member and friend wh are cnceined abut the ubtance abue r behaviral prblem f a lved ne Familie nnymu meet weekly frm nun) pm Thurday at the Park Ridge Crnmunity Church loo Curtland ve Park Ridge: ue the ide entrance r) Butler Place There are n due r fee Firt name nly are ued at the meeting t preerve annymity Thi i a nnprfein al and nnreligiu prgram dvance ntice i nt neceary iitr are alway welcme Call the church ffice (847) 8233164 r Calendar PGE 20 i i PRK DSTRCT 4 Î ea The NUe Park Ditrict pnred an afternn tea party fr girl and their mm grandmther r aunt at the 1lward Leiure Center pril 25 The ladie and girl in attendance were dreed in tyle a they dined n freh fruit and andwichewhile ipping lemnade r light tea NORTHWESTERN S LLNOS Gurdak 4 f Nue make her Prlecling her bnnet frm gut f wind Kelly afternn tea party tr girl and their wy int the Nue Park Ditrictpnred Leiure Center pril 25 (llen mm grandma r aunt at the Hward Kdleta/Fr SNG) Park Ditrictpnred al 1er Friend Elia dreani 7 (left) and Sibel Trung 8 amue themelve with a game f pattycake befre the tea i erved at the Nue pril 25 (Pllen Kaleta/Fr SNG) aunt at the Hward Leiure Center nn tea party fr girl and their mm grandma r 4 MY i T 3PM MY 2 T i PM MY 3 T i PM LL HME GMES PLYED T RDCKY MLLER PRK NORTHWESTERN S OHO STTE il 1PM MY 2 T i PM MY 3 T LL HOME GMES PLYED T SHRON J DRYSDLE FELD 3RD NNUL PURPLE UCTON ON MY 2ND $5c1/DULTS ND $2/1 ô u íw i u ND UNDER tea party pril 25 Ditrictpnred afternn at the Hile Park abella Chn 4 f Hile chat with friend at her table li girl and their mm grandma r aunt at the Hward Leiure Center Guet were treated t light tea lemnade freh fruit arid andwiche (llen Kaleta/Fr SNG)? daughter Melanie 6 (center) arid her friend Etrella Mritanya 4 t tre Nile Park Hping t beat the rain Cpi Marin (right) f Park Ridge ecrt her Ditrictpnred afternn tea party frgirl arid their nm grandma r aunt at the lward treated t tight tea lemnade freh fruit and andwiche (llen Kaleta/Fr STNG) Leiure Center pril 25 Guet were

+*tlarlem 20 wwwpineerlcacm THURSDY PRL 30 2009 PRESS PUBLCTON wwwpineerlcalcm 21 ; _J c: Ti c iv UCT!ON SERCES GROUR NC Etab/ied 1994 Calendar Cnilnued frm PGE 18 Sight and Sund Plaza NE42OO9 RNK DRECTED NEW LUXURY HONES CONDOS &ESTTE HOMESTES hghlnd PRK Nrth Shre Etate 1098 Sheddan Rd Highland Park L Orlglnalty Priced t $3195000 12 rm 10700 SF finihed living pace 5 bedrm 64 bath etate hme Gurmet Kitchen with many upgrade Decrative tne tite & chan) wd thrughut Lavih mater pa 4 Fireplace French Prvinciat with dramatic tw try fyer NPR LLE Hbn Rad Etate 8S061 ndiana ve Napervllle L Orignally Priced t $5500000 26 rm 15000 SF S bedrm 5 full & 54 bath etate n 25 cre firt flr mater ufte lt level acceible by elevatr 5 Fireplace; 4+ car garage Smart Hue Guet ufte tdne rm wlh auna & team Wine Cellar with tating rm Hre allwed ENSTON Luxur Cnd 2935 Central St Evantn L Originally Priced t $349000 New large 1550 SF 2 bedrm2 bath unit Spaciu flr plan Gurmet kitchen with upgrade Heated ndr parking; Private balcnie; Elevatr Slid manty cntructin with architectural detail Walk t hp chl & tranprtatin WOÓDST eck 3 Sanctua f Bull alle Hmelte The Sanctuary f Bull alley an excluive 2OO acre envirnmentally prgreive develpment near the City f Wdtck Jut 50 mile frm Chicag Hme alue t the Upper $1000000 Originally Priced t the mid $100000 cre acre hmeite Excellent Wdtck cht City ewer & water Cnveniently lcated near hpping & cmmuter tran CLL OR EML FOR BROCHURE WTH OPEN HOUSE SCHEDULE BenJ E Sherman & Sn 8473742710 cmr@agauctincm L Ucene 4440000177 YOUR MONEY dent g t Wall Street 7460 W Mrt Path Rd Nrrdge 4108 N Harlem y Nffldgi 5001 W Belmnt ve Chicag 3555 N Hartem ve Chicag t tay n yur treet Be part f ur family We fcu right here at hme n yur treet Frm ur wner t ur teller we all live wrk and play in thi cmmunity and we have fr 50 year What mre we invet ur aet in lcal hme and buinee When yu bank at Plaza Bank yure mre than a cutmer Yure a member f ur family Bank r Be part f ur family 6500 W living Park Ra Chicag 6000 W Mntr ve Chicag 379 River Rd Dea Plaine 7455 W Grani va Eimwd Park (7Ò8) 4563440 (773) 6254100 plazabankiflinicm 4660 N larlm ve Narwd Height 7201 N Harlem ve Hile 5Q1 1 PDC cntact Familie nnymu l800 7369805 r wwwiamllieannymurg Butterfly Grup fr Bereaved Par ent meet the ecnd Tueday f each mnth at 1:30 pm in the St Jhn Brebeut Rectry 8307 N Harlem ve ll bereaved parent (amity and friend are welcni? whether their l i recent r many year ag Call nna LaCrte (847) 9652771 r the rectry (847) 9668l45 Mdwet Palliative & Hpice CareCenter grief upprt grup meet at variu lcatin acr it ervice area Giie( upprt grup are tree; dnatin are accepted Call (800) 3315484 t regiter The chedule fr 2008 winter/pring ndude: t 2050 Claire Curt Glenview dult L 6:308 pm Wedneday; Daytime Spue L t:30 pm t 3 pm riday; Evening Spue L 6:308 pm Tueday; Sudden L 6:308 pm Mnday t 6)33 N: Nrthwet Highway Chicag Familie with Children L Grup meet every third Mnday 6:307:30 pm r in Glenview 6:307:45 pm Wedneday new lnn grup i being lrmed at Meiah Lutheran Church 1605 ernn ve Park Ridge Fr infrmatin call the church ffice (847) 8236984 between 9 am3 pm during the week Tite Natinal lliance n Mental llne Ck Cunty Nrth Suburban invite the public t attend it Car ing and Shaung mnthly upprt grup Thi grup i fr family and friend F peple with a mental inne and ffer the pprtunity t hare prblem and learn hw ther have vercme them Thi prgram free and meet frm 78:30 p10 the firt Mnday f every mnth at the KentnKnx Cnference Center (Ruh Nrth Shre Medical Center) 9701 N Knx ve Skkie Call NM CCNS (847) 724 1460 r viit wwwnamiccnrg Nrthwet Suburban ntertitial Cytiti/Painful Bladder Syndrme Supprt Grup f llini meet at 7 pm the ecnd Wedneday f each mnth in dvcate Lutheran General Hpital 1775 Dempter St Park Ridge Cnference Rm 1064 E mail: bzarnikw @alcmt be added t the email lit fr meeting annuncement The Maryville Crkl Nurery 4015 N Oak Park ve Chicaq ffer a afe harbr fr children 5 and yunger when parent have nwhere t turn during a family r pernal crii t a free centerbaed prgram where chldre may tay fr a lng a three day t gal i t prevent abue and neglect f children and help a family tabilize it ituatin by prviding upprt and reurce Example f a crii include dmetic vilence parental tre medical emergency r repite care The 24hur Help Line i (773) 2053637 n area lzhelmer upprt grup fr careqiver and family member f peple with lzheimer Dieae meet at 10:30 am every ecnd Saturday at Central Baptit illage the Cmmn Theater Lunge 4747 N Cant ed ve Nrridge New member are alway welcme Call Jei Lenth grup facilitatr(7o8) 5838509 Queen f ll Saint ht a week v meeting fr female urvivr f exual abue The meeting are frm 78:30 pm Mnday in the Benedict Center Chapel 6275 N nia T participate in the cnfiden (ial 12tep prgram call Oueen f lt Saint Rectry (773) 7366060 dditinal meeting are frm 78:30 pm Friday at St Juliana Parih Center 7200 Ocela ve Call Linda (773) 2712281 Teen Center The Nite Yuth Cuncil i a grup f teen frm ixth thrugh 12th grade wh prvide upprt and advice n Teen Center prgramming develp leaderhip kill and wrk t erve the Hile cmmunity They meet the firt and third Thurday f every mnth at 5:30 pm Stp t check them ut Call (847) 3758949 The Teen Center lcated at 373 Glf Mill Center n Hile The Teen Center wrking with the Hile Senir Center t find teenager willing t help enir citizen with leaf raking nw hveling and general yard wrk while earning mney Cmplete the Hile Teen Jb Cnnectin frm available n the center Web ite and return it t Mark at the center nfrmatien will be hared with the directr f the center and cntact will be made with reident n need f ervice Reqlter yur bike thrugh the Hile Teen Center r Hile Plice Department Every year the Hile Plice Department accumulate a number f lt r tlen bike and i frced t ell them at an auctin becaue their wner cannt be identified By regitering yur bike yu are iued a illage f Hile Plice Department ticker and yur bicycle infrmatin i cnteredinl a natinal databae allwing the Plice Department t recnnect yu Fr enhanced cverage f peple and place in yur cmmunity check ut Pineer Pre vide at wwwplneerlcalcm if it i ever lt r tlen lunteer Junir chievement f Chicag i a nnprfit rganizatin fcued n inpiring and preparing yung pepl t ucceed in the glbal ecnmy ldteer frm buinee are trained and given material t g int a ctarbm and teach tudent frm kindergarten thrugh high chl abut financial literacy and entrepreneurhipwrk readine kill Partnerhip have been frmed withme teacher at Hile Nrth Central and Wet High Schl fr J prgram thi chl year lunteer are needed Each prgram cnit f five viit t the clarm fr abut 45 t 50 minute each f ntereted call Kritin Gdwin peratin manager Junir chievement f Chicag (708) 4561400 Ext 245 email kgdwin@jachicagrg r g t wwwjachicagrg The Men ciatin f dvcate Lutheran General Hpital ha recently expanded it rle and memberhip bae n the cmmunity and adpted a new name t reflect that change; The Men and Wmen ciatin f Lutheran General Hpital The change will allw the nnprfit rganizatin t pnr mre event encurage greater participatin in annual activitie uch a the gqlf uting and fundiaiing ale expand pprtunitie fr men and Wmen t take n leaderhip rle and ncreae cllabrative effrt with the hpltal develpment ffice Service Leagua and the dvcate Chantable Fundatin The rganizatin dnatin have aited Lutheran General n expanding it prgram purchaing tateftheart medical equipment and puruing reearch and educatin effrt Call (847) 7236105 Wrkhp erlzn Wirele i hting a free handn rd wrkhp at enizn Wirele 9635 N Milwaukee ve The wrkhp deigned t better acquaint PD uer with their rbile device and clear up the cnfu ln arund their many feature Regiter at wwwpdawrkhpwdvzwcm FREE SHPPNG 1866MOBL1TY TTCOM ST STORE NOW OFFERNG FOUR GRET SERCES! Wirete lame Phne dvanced T HighSpeed nternet +*DwirrrCrv! 2321 OdnMe Ste 4*Wixlitnck 665 5 E4wd Or +*Saaib 51gm 312 5 Rvrtdtl Rd Yrktiile 731 Etici Cine +*GUmÑ 6170W Grind ve :17 +*ílbum 920 N hum St tnos +*t Charle 2700 i: Main S +*u( Cre t O ieikifieid id OtCW Strni 173 1 US Rut 6 +*7075rafl(t tte 4*igiinquln i492 5 Randall ncl +*erna 111th 415 E Ttriine liti 51v C +*H1Rtand Park 36 Skkie dlvy lid *Gtencle teiht 2232 UirxvinrdrkRd +*L5ntn5 2390 E 172nd S 4 *iigln Height 1i2 W Dundee Rd +*Wr Cunden 729 W itjio S +*tlmewd l78s S ilaited St +*Glen Elln 547 Reelt Rd +*iqxi N riirrgici UiL Rd " +*lliel 3340 Stu 10011 Dt Ste 254 +*NbraOfl l Daflttl SC +*lighlavd Park 671 Otri Skkie Rd NDN 4*v;r 4412 ENLWYO(kSL +*dgkilii Çi)Oiiel Rd tiret 300 +Gntfiih 141 N lititt S +*ta Cr:nge il N 11 Grnigt? liti +*umrnigdae 524 Strathrd Sq Mall 55524 NDN #*Hò1fmn StSiS 4&l0l1fflCfl flhd *Menittville lin) SuhCktMrli +*tincetnwaad 1333 W Tuhy ve OO2 +*th)linglrnk 720 E Uughtn Rd Sie 109 +*Merriiivitic 2h29 E 80Cl) ve *jdt0e 1273 US i hey t +*MchenTy 3017 W rit S *Hnrrr Glen rixi1 S lieti Rd g *Caiume( City River Oak Mall % River Oak Dr +*Michgri City 5310 Frrviiin S +*Scheeeritle i SOS US Re 41 +*Jncln*ttlte hd M4WUk5teB +*chicaga 4*Mkcp i 1244 W Unvvlii hitty 1 lot S Canaf St 4*ucprt 1027 1 Oui S + lhn 3607 Wicker te 4*1411er 3479 MitwtUkeeve +*ifl4 N SidgwickSt \ryjj1ui3o1 CheSS +*Muheney Lark 1574 \ehiiie Rd *lparah 2912 N Calutel te +*Nrrid&r 11 55 iii N littlent ve +*ir0 N Stati St LtNOiS *Malten 4716 tincs hy *17J0W ruleuve " iiivghutlsc 32 +*ridirnri 43 W nkt S Sepictj tir Epiñl +*Nprrille 60 1 Oglien Me +2 t5 W Mnre Si : +*Nrihrke i 14 W Nrth n +*421 5Wrhiiigin S 4*17 5 W 2trttr S +*Øak tawn 5251 W OSili Si 4*reea t 330 OrchOrli Rd *01)011 Suiviry *Benyn 6621 WOgdevMe +*iç W Diverey PkW5 i *O!rWa 36 SLvlflr1 Rd f; +ytigh Sticed lnlerifll 5kt Hein +*Oaltpark 425 N itrinnr ve t +*LilinRtirOOk 210 N Wvixr litt +*S7 iciricgve +*Oakbrk Terrace r7woi W 22nd Si +*Peru Kr 251 enzvi Rd +*7i3O S Cicer ve +*Orlrtd Park ii35 5 it Grvge Rd +*ßradtey 1(00 N Stale brite 50 Ste lo SLtU:Cj dclt2lt1 +*Rprmant 7024 N airntwinl liti +*Uradricw 11 lirttltie" village SC FleiTt riot ici530i5 + *l658 S Ceitage Crvç rr 4*Oveeg 2754 Re 34 Latrad Lake Brach lb E RUle Rd *Chcrry varrey 224 5 trryvtlr Rd 4 *J27 S \eten ve +*PerJ 437 i enture Dr +*SchauflbUt5 2644 w 5chrurnbum litt 4 *Crrlwud 1756 W Cal Sag Rd +*plainlietd r2720 S Rie 59 51v 300 +*Chtcag 457 53bSt +*SummU 72i2ó W rchet RadiShack l*isij N Mitvrukve tt 4*Crytal Lake 4912 Nrthwet Hwy Ste +*1inleyPa tl9 S Ovk tkme (i +*Rcfrd 11270 C 5110 St +* ; c 7i C mit R *C1errnlie Mdi 20(1 i UnOn tt 1113 +*320t N Cicer te +*71B W 81tiS +*J94( N tinvtn Mv +*Ueer ar " rv Rct Ste S Ñ GfLv By +*Relling Meadw 635 ttivuviutit Rd *3SS W tlmvni te [imhurtl 110 N YççRd +*Sclraunibarg 14011 1 9tiRti +*Wi CkR 27 W 245 Nrth te +*4iS t 35th Si +*[tan) 620 ChicaR ve +*Wdfietd Mdi Unti F 23 +*%illark HiO7StitSt fs S ttstii S +*Ceneea 1749 Radr}l Rdie O +*S&aO 9725 N Skkiellivd The mat phnethat wrk mthe mt cuntrie bligatin and charge lmpe bytatdféterat tcm régutln State end FdraUfl1erSal Service charge; and ctincurred n cmplying wfth $125 t help defray T&T impe: a RegUlatry Ct Recvery Charge f up t g0ymentrequd charge fee are nt taxe Or Subcriber mut live 8 have a naitlng apply Sue cntract & rate plan bchure fr detail urcharge fr gvernment aemefl Da T&T Thee ffer Other cnditin & retdctln tre lcr detail Limitedtime il cancelled n the flrt 30 day but up t lrall area SeeC0vege map at ndependent retaler Early Terminatin Fee Hne by nirk & may nt be available trc 011er available n elect phne Cverage i nt available Equipment price & avait may vary lndvidal N additinal dicunt are available with Up t $36 artiv lee applie vice emlce Unitd vice vc aie prvided lely n Uve dialg between tw addr within T&T wned wirele netwrk cverage area impe addi tee Unlimited flnet uage allnte T&T may at l ptin terminate yur c deny yur cntd ue t $115 Sme agent tw cnecuthe mnth exceed yur $20 íetcklng lee may apply t equipment return; therealter unlimited plan Offnet Uge: lt yur win el ue (including unitd c) n ther caui5 neiks (llnet uagel dling any (dataefffletusagealiownce i the leer 40% nl the nytime min inctd with yur plan equal t the leer f 750 mln r Yur ttnet uage allwance $4999 repectively Sanuung charge tr tlnet uage &with 2year vc agreement per phne are 517999 & minimum $25/m data plan required at thr carrier cverage r change yur plan t ne imping uage tutre T&T Prmtin Card Prpl price belre T&T Prmtin Car minimum $25m dath plan Card: Samung Eternity price per phne are S24999 & $4999 re?eeiy Samu el 6 HR r 20% f the KB lncld with yur plan) T&T Prmtin & with 2year c agreement but nt redeemable tr cati & cannt be ued fr cah $25/m data plan required & vald ter 120 day alter uance date Card may be ued nly n the US mprein price befre T&T PlWtin Card minimum llw 60 day tr lullillment receive card Sate tax calculated baed On price cl unactivated equipment 2O0320O8 & $4999 repectively cutmer lt 30 cnecutive day t reuired K with 2year c aiéeent per phne are $9999 05/19/2009 & yu mut be a be pntmarked by Nbility ll right reered T&T the T&T lg and ali ther mark cntained herein arè trademark Prperty SeWice prvided by T&T wil)idíawal at M Ói autómated galine pump Card requet mut 2O09 T&T ntellectual trademark l Napter LC repective wner Unpter Napier T G and the Napter tge are regitered herein re the PrPertY el their ll ther mark cntained et T&T ntellectual Pperty and/r T&T lfthlated cmpanie ket_t_

Philip 22 :u) wwwpineerlcalcm THURSDY PRL 30 z DSTRCT 201 Jirty Maine Suth High Schl fah in tudent recently cmpeted at (lie Family Career ad Cmmunity ftader t merica tate cmpetitin ir Sprintied Te Chppe tk Jut place n the prm drer delqn cateqr and Unday Wanchl tk tut place l emifrnal dre Deirdre Smith al tk firt place in lawin deign and Melia Magunn lk firt place in recycled cntructin Smith and Maunn will n l cmpele in the natinal rmpetitian n Nahville lenn Member f Maine Suth martial art club tk hme hitr mark in the 2009 Regin 5 Wrld Tang Sa D e SCHOOLS DiGEST i\cialln Turnament Lule Cr dn tk ecnd place in Frm: Wn tn PuQ$a3 tk third place in trm; Nick Jacbn tk ecnd place in Frm end third in Sparrinq: Jimmy Kulka captured third place n Frm; an Mari Raine tk ecand place n Sparrinq and third in Frm 14ORTFRDGE PREP JENS LST lec Brennan Matthew Brwn ndrew McDnuqh Jame Snitzer William Thrntn Jacb Krupwicz Derek Simn Benjamìn Sturgen Pedr cta Thma Carden Willam Cheely Brian leahy lexander Lpez Thma Luca JhrtRadlinki Michael Stanel incent Rinal Timthy Madìgan Mlrammad bdel Fattah Gerqe dam Dytan Haig Tikku Gerge Matthew Badyna LawrenceBilell Bartz Bak nkang (Richard) Ban Jhn Falc ndy Lui Jae Yung (Tm) Sb Bartlmie) Radzik Thma DieHenthaller David Rahimi Jhn Rahimi Peter Knapp Jhn Sander Michael idvic aac llterman Mark Culjak Matthew Grilfin Michael Pma Jhn BirminQharn FRST HONORS Michael HanrettyJeph Hinderer Michael Kane Peter Kane Jhn Pen SÜMMR D!SCOTC?Y CMPS June 15 ugut 21 2009 9 week f ummer camp prgramming Mrning and afternn ein Handn learning and fun Supervied indr/6utdr play L Fr children age 35 Mre infrmatin:(847) 8326918 r viit :*WakhchíJdreflmueumrg/caflip net Marc Ri Mark William Matthew William an Cali Kyle nten Philip Krupwicz Wnjik Chun Preveen Ea Hlctla Flannery Daniel McDermtt Timthy March Michael Owald Dea Rinnan Davìd Zdunek Daniel Diaz Jeph Brchu Peter Demki ram Nadeem Sylveter Srka Mark Gigante Daniel Tarchala Matthew Kaier Philip Kaier Jeph Cnry Jeph Klatt William Fx Nichla Gallway Peter Madiqan Sung Je Hyun Jun Yung (Nick) Sah yub Mhiuddin Jun Yung Park Cannt Sctiickel Brett Balaa Gregry Knapp ndrew Kuçzynki William Sander Charle Schulze an Sheller! Brian Taylr Jhn Thurb Gregry MendezWeek David Griffin Daniel Jl SECOND HONORS Philip Devi Jeph Hanhetty Peter Hirrierer?am Hiirn Tyler Kaputka idan McNally Peter Baca Matthaw Witta Chritian reval 1iiliam Ealtran Jutin Betz Jimmy Calrera Timthy Chlda Julian Cleman Cenar Dyle drian Febu jcln Hedly Ctrarle Janatha Jahn Leatr( ththcny Mntante Martin Navarrete dnan Sauceda Randen Trcha Jhn Wfralan Brian Bland Peter Bland Jhn Cyle Patrick Lechnec Jan Bee Samuel Femandez Matthew Jarlawki Jeffrey Ketler Je Tamay Michael Wjnr Paul Brm Canali Brannn Liarn Brannn Matthew Bennett Tyler Maricich Michael Gigante Patrick O Cnnr Jhn Hauff Yung Hwanq Jun Kyu Jean JeS Kaduthadil Jhn Kaier ndy Shin Matthew Kzil Sng Sanghyun Chritian vn Haldt David Strenk Fret Me Jhn Klatt Peter Tihuk Jeph Kelly Nathan Kelly dam Yuman Rbert Battin William Cleveland Matthew Gallway Edward Bleka Benjamin Kiernan Cnnr labi Miguel Trte Jeph dam Jacb Jaeckel Jame Petr Ye Chan Kim Davia Nuccl Kang Yel Yun Rbert Lechmner Bryant Balaa Luke Dieffenthaller Nichla Rahimi Jame Beck ndrew ngraham ndrew Knapp ndrew Murphy Jan OtjicRey Rbert Nichla Zari Jhn Zurawki Thedre Huntingtn Jna Kupry Daniel Segvian Paul Carter SpyrittinPyrr Rubani Kevin Birmingham Kevin Cnry DSTR2CT 219 Under the guidance l Nue Twnhip High Schl Ditrict 219 faculty and tudent area enir citizen participaled in a Digital Strytelling pcçram t bring their pernal trie t life while uing the latet technlgy Thi year participant creened their riginal prductin in a public debut n pril 21 in the Rbert L Jhnn uditrium at Nue Wet High Schl Skkie n an effrt t hare reurce with the cmmunity the Technlgy depamtment at Ditrict 219 ha been ffeting free technlgy wrkhp lar lcal enir citizen ince 200& Nt nly are enir citizen exped t tatettheart technlgy in a friendly enviwnnien but their trie preerve cherhed memrie which can pen the line al cmmunicatin between generatin Participant learn hw t craft and ditill memrie int a trng and cheive narrative can memrabilia and pht and recrd their narratin t prduce the final prject a a bril vide Fr mre infrmatin n Ditrict 219 Digital Strytelling prgram g t wwwdígitaltrierg( T regiter (r a future prgram cntact Daphne Watn at (847) 6263930 t a recent igtng day event fur Nib Nrth High Schl tudent cmmitted t play prt at the clleqiate level The igning clay wa rganized by Nile Nrth Head Ftball Cach Sctt Smith Student at the igning included: Running back Terry Thrner llcnference and Central Suburban League Nrth Offanive Player f the Year will play lar Ellwrth Cmmunity Cllege in wa Fall 1 running back and defenive crner Michael Dtn twtime ll Cnference player will uit up fr Lake Fret Cllege; tight end and dafenive end Berçeau Saintil igned a letter f intent fr Ellwrth Crmunity Cllege: and Guard Nicle uif cmmitted t play baketball at Oaktn Cmmunity Cllege De Plaine Fur Nife Wet tudent received (rphie at the llini Drafting Educatr ciatin tate champinhip held at llini State Univerity thi mnth w Hile Wet tudent are tate champin OQrek Wn wn fict place in Machine CD and Bank Kauthld wn firt place in Machine Bard Teammate ndrew Lee placed ecnd in Machine Bard and Thea Ledema placed thìrd in rchitectural Bard fine Wet art teacher Jhn Ztewlcz wa accepted t the Schl at the rt ntitutel Chicag Teacher ntitute in Cntemprary rt He ha al been accepted t the ntitute Studi Extenin immediately fllwing the ein The Studi Extenin allw teacher t cntinue their tudi practice uninterrupted fr an additinal week and will take place thi ummer Only 28 teacher acr the United State are elected fr thi pprtunity During the cure f the prgram Zilewicz will experience cntemprarj art practice with leading artit participate in dicuin with natinally knwn lecturer ir cnlbmpramy art and thery and explre current pacíaqqical iue and the impact f mueum reurce n curriculum OKTON Prpective tudent and their (amilie are invited t viit Oaktn Crnirtunity Cllege 1600 E Gall Rad tarting at 4 pin May 5 The campu viit feature ìnfurmatin abut 0aitn admiin prce caraer prgram tranfer prgram f nancial aid tudent ervce athletic and extracurricular activitie Daktn faculty adminitratr halt and ndent will prvide tur and anwer quetin lege r univerity a well a the preparing (r emplyment in a variety f career Oaktn i acdredited by the ligherlearping Cmmiin and i a member f the Nrth Central cialin lin Cmmunity Cllege Bard and merican catin l Cmmanity Cllege Learn mneyaving and mneymaking technique lii clae ffered by the lliance fr Lifelng Learning at Oaktn thi pring Refkemeaf Planning Tdav(FN COZ 08) hw hw t integrate finance with gal t create an early retirement plan Threeweek cure meet 19 pm Wedneday tarting May 6 at Maine Wet High Schl 1155 S Wll Ryd De Plaine Cure fee i $35 Make Mney frm Survey (BUS S68 03) demntrate hw t make extra mney in yur pare time by participaling in paid urvey Oneein cure meet 810 pr May 7 at Evantn Twnhip High Schl 1600 Ddge ve Evañtn Cure lee i S $19 Cníructin Truble Bubble (1CC [7102) er inight fr the cnidering new hme cntructin r a ma r renvatin prject Oneein cure meet 10 am4 pmmay 9 at Oaktn De Plaine campu 1600E Glf Rad Cure fee $120 Fr a cmplete lliance fr Lifelng Learning cla chedule viit wwwaktnedu/all r call (847) 982 9888 pre 3 Gain a deepei inight int a claic mericanmagazine by enrlling in a cla ffered by the Emeritu Prgram at Caktn thi pring The New Yrker(HUM E9373) fcue n electin frm the phiticated magazine etallihed in )925 ubcriptin i required Threeweak cure meet 9:3011:30 am Mnday tarting May 4 at Oaktn Skkie campu 7101 N Lincln ve Cure fee i $39 Fr mre infrmatin call (847) 635 1414 r (847) 9829888 pre 3 Fr a cmplete lit f Emeritu clae cure fee eminar and event viit wwwaktnedu/emeritu Explre the vat culture and natural treaure f Ecuadr thrugh a trayel/tudy prgram pnred by Oaktn Cmmunity Cllege Trip in 2009 depart in May July Octber and Nvember Begin n the450yearold capital city f anita and experience Jacchlgua the Ecuadrian flklre ballet iit Owald Guayaamin gallery f cantemprary painting and take a day trip t Caldern hme f native bread dll Enjy a evenday Galapag land cuìe that nclude utdr adventure at the Charle Oarwin Reearch Statin and Pinnacle flack Participant iii bi phyically deuiandluq trip huld be in gd health n ptinal weeklng exten T regiter viit wwwaktnedu/admiípenhue/campuviithtm r in t Peru Machu Picchu i tfered at an additinal ct call (841) 6351629 "" Fr cmplete itinerarie and infrma Oaktn Cmmunity Cllege ffer a tih thtùtupcmlng 2009 and 2010 atiate degree and certificate pr tur call Rea Crnelien at (847) gram fr tudent preparing t earn 6351812 c viit a bachelr degree at a furyear cl wwwaktnedufnew/firt/travelhtm PONEER PRESS PUBLCTON prpectve tudent and their familie are invited t viit Oaktn Cmmunity Cllege 1600 E Glf Rad tarting at 4 pm May 5 Stia campu viil leature infrmatin abut Oak n admiin prce career praid tudent ervice athletic and gram tranfer prgram financial evtracerricular activitie Oaktn lacily adminitratr tatt and tudent will prvide tur and anwer quetin T regiter viit wwwaktn edu(admisipenh0u5e/campu55 it hm 01 call (B47) 6351629 Oakln Cmmunìty Cllege tter aciate degree and certificate prgram fr tudent preparing t earn a bachelr degree at a turyear cnlleqe Or univerity a well a the pteparlflg br emplyment in a variety OPEflT TRMSFERS nfwmril in i prvided by Recrd fflfo!!(itiofl ServicL nc in St f h(t!/cs urwwpublicrecrdcfli ((1W) 365ôWO NuES 8309 W Park ve Rafal Jurwki t itr Gruzka $180000 Jan 20 8801 W Glf Rad pt 7G Greg Martin t Lrizan Dimane $111000 Jan 20 8709 W Bruce Drive Chicag Title Land Trut C t Brian C Stauntn and ngela L Stauntn $445000 Jan 30 a 5801 Dll Rad pt 11E nne Sirnnen t Neena Oza Krihna Oza $95000 Jan 30 u 8064 Prpect Curt Brian Stauntn t Nah Schrer and Hillary Schrer $325000 Feb 5 at career Oaktn i accredited by the Higher Learning Cmmiin and i a member f the Nrth Central ciatin llini Cmmunity Cllege Bard and merican ciatin at Cmmunity Cllege Learn mneyavng and mneymaking technique in clae ffered by the lliance (r Lifelng Learning at Qaktn thi pring Retirement Planninp Tday (FN EO2 08) hw hw t integrate finance with gal t create an early retirement plan Threeweek cure meet 79 pm Wedneday tarting May 6 at Maine Wet High Schl 1155 S Wlf Rad De Plaine Cure lee i $35 Make Mney frm Survey (BUS S68 03) demntrate hw l make extra Web page Fr a niere detailed decriptin f the iue ee ur at wwwpuneerlcalcm and pick yur hmetwn paper cluck n New and click On Plitic Pineer Pre By TONY BERTUC tbertuca@pineerlcalcm OKTON NOTES mney in yur pare lime by parhicipaling in paid urvey Oneein cure meet 8O pm May 7 at Evantn Twnhip High Schl 1600 Ddge ve Evantn Cure tee i $19 Cntruch Truble 8ubbìe ttec Cil02) ffer inight fr the cnidering new hme cntructin r a majr renvatin prject Oneein cure meet O am4 p m May 9 at Oaktn De Plaine campu 1600 E Gall Rad Cure lee i $120 Fr a cmplete lliance fr lifelng learning cla chedule viit wwwaktnedu(all r call (841) 982 9888 pre 3 Gain a deeper inght int a claic merican magazine by enrlling in a cla ffered by the Emeritu Pr NflES LU3RJ Library celebrate 50th The Nue Public Library celebrated it 50th anniverary pril 26 with a birthday cake and live muic frm a 1950wtyle quzr Let Parent and children created a time capule with bject they wanted t hare with library viitr in 2059 Patrn pcketbk vere hwn ue leniency when the ìibnary nlled back fine n verdue item t 2 cent in bervance f Natinal Library Week Chritpher Hill a US ambaadr t raq Backer mbaadr t raq: Senatâr vted 7323 t cnfirm aid he wa nt tugh enugh a the Buh praied hi freign ervice career l 32 year while critic adminitratin chief negtiatr with Nrth Krea ye vte wa t cnfirm Hill Sen Richard Durbim Ye; Sen Rland Burn: N vte Whitleblwer Reward: Senatr refued 3161 t cap at $50 millin the reward fr whitleblwel wh ue the Fale Claim ct t help the Treaury recver fund ht t lraud ye vte wa t retain rule that allw ucceful pla)ntitl t receive up t 30 percent f recvered US lud(s 386) Sen Richard Durbin: Ye; Sen Rland Buni: N LS Water Plicy; Member vted 41310 t imprve the wrk f the 20plu agencie cncerned with auring the US ha vte wa t adequate water upplie and clean drinking water ye pa a bill (HR )145) that create a White Hue ffice t treamline and fcu US water plicy Cmmunity Plice Fund: Member paed 34278 a bill (HR prvide lis 1139) t expand the Clintnera COPS prgram which grant fr the hiring l lcal plice llicer ye vte wa t and helping authrize grant fr purpe uch a hiring precutr chl fight drug and gang ul1j!k4 u 12 Bbby Ruh 0it Y Y Jee Jackn Jr 02ndN N Dan Lipinti 03rd Y Y Lui Gutierrez D4th Y Y Mike Ouigley 05th Y Y Peter Rkam R6th Y Y Danny Davi 07th i Y Melia Bean 08th Y Y Jan Schakwky 09th y Y Mark Kirk RlOth Debby Halvrn 011th Y Y Jerry Ctell D12111 Y Y Jud Biggert Rl3th Y Y Bill Fter 014th timthy Jhnn Rl5th Y Y Dnald Manzull Rl6th Y Y Hare 011th arn Schck ßl8th Y Y Jhn Shimku Rl9th wwwpineerlcalcm Y Y Y Y Y Y Y N gram at Oahtn thi pring The New Yrker (HUM E9313) f a cue n electin frm the phitirated magazine etablihed in 1925 ubcriptin required Threeweek cure meet 9:3011:30 ar Mnday tarling May 4 xl Oakln Skkie campu 770l N Lincln ve Cure fee i $39 Fr mre infrmalln call (841) 6351414 r (841) 9829888 pre 3 Fr a cmplete lit f Emeritu clae cure tee eminar anti event viit wwwaktnedu/emeritu Explre the vat culture and natral treaure f Ecuadr thrugh a travel/tudy prgram pnred by Oaktn Cmmunity Cllege Trip in 2009 depart in May July Octber and Nvember Begin in the 450yearld capital city l Quit and experience Jacchlçua the Ccuadrian (lkire ballet iit Owald GuayaaminS gallery f cntemprary painting and take a day trip ta Caldern hme f native bread dll Enjy a evenday Galapag land cruie that indude utdr adventure at the Charle Darwin Reearch Statifl and Pinnacle Rck Participant in thi phyically demanding trip huld be in gd health n ptinal weeklng externin t Peru Machu Picchu i lfared at an additinal ct Fr crnplete itinerarie and infrmatin abut upcming 2009 and 2010 tur call Baa Crnelien at (847) 6351812 r viit wwwaktnedu/new/f irt/travelhtm Hrnzrzingtn Cateizíng & DeL lf!:5 5685 N Milwaukee? Chicag L 60646 wwwharrirngtndelicom Pvli flur Mnday Saturday 11M 7PM Sun4ay Cled Catering 7 Day a Week! Nw Serving Crned Beef Cabbage Dinner Thedny & Saturday 11 M 7 PM Hmemade Sup & Sandwiche Daily 7732838388 Brwe ur elec(lfl f (ri5h Gift Stiir & Grcerie OO re 1rt0 t Grve GRDUTON COMMUNON (alecjug Sjeeeial p tvl 629 (tttt:phh gittict ltiiinrid littt )T Ptit tlt li ihm l;i ll FT id ci li PÇr k hi t rtnii: Ptii \ f liiiiiinlc \ ti ti : t twt f rk ( hi ti thi:kt:ii l03q Si k ()nhei pikigc t in lihl call 773UXT>5 lr erce the chtl1j:tloflth fr May 1 > il4 " Gd Çarrnè CntruötÒ& 4j 5414 Oaktn St MóÌtti GrQe P; " 84798O97O newy:; 123 PEOPLE & PROMOTONS htte Dame High Schl phmre Matthew BatdelU cllected and dnated mre than 200 blanket fr critically ill children a part al hi prject t attain Eagle Scut tatu Bardela received the Hile Yuth f the Year ward at the Night 01 Rne n pril 25 at White Eagle Banquet in Hile twyear clarinetplaying namber f the Nire Dame/Reurrectin Band and the Jazz Band Bardela i al in the SciFlFantay and Gama Club at Ntre Dame He i a recent recipient at ne 01 the Chicag rchdicee icariate l ward fr cial jutice and cmmunity ervice

Wedneday St 24 wwwpineerlcalcm THURSDY PRL 30 2009 P J ON [ER PR ESS PtJ BLCTON wwwpineerlcalcm 25 $r" t y rr n (tl\ dnb F tt/ "4 t <? v *rçt tøç eekly rhip g4""» Weekly Wrhip? CHCGO Edin Prk United Methdit Church 6740 Nrth Oliphant venue Chicag l 60631 Phne: (773) 1923030 Fax: (773) 7923031 wwwedinparkumccm Email:patr@edinparkuriwcm Wrhip Ony & Hur Sunday 10:30 M Ptluck 11:30 M Sunday Schl fr Prechler & Nurery ge Rible Study Thurday 10:30M & Friday 7:00 PM Yuth (High Schl) Rible Study Sunday i :00 PM Yung dult Bible Study : Sunday 12:00 PM Chir Practice: Sunday 9;30 M Suannah Weley Club (WmenGrup) Meet nce a mnth n 41h Tueday f the mnth Yuth Wrhip Sunday 3rd Sunday f every mnth Pdtr Rev Jerry Miller Organit Dnò Samva Muical/Yuth Directr Nrlyn Barja Senir Exercie Cla Tueday & Thurday 8:30 M Fellwhip Hall Jame Dwning Theatre Perfrmance Edin Park United Methdit Church i a church with Open ; Heart Open Mind Open Dr Chair Lift vailable Parking in Rear The Edgebrk Church ; 6155WTuhyvenue (713) 6311155 : hp://edgebròkchùrchrg Sunday Wrhip 10:30 M Enembleirctice 6:OPM Praie;Prayer& BibleStudy; ; Wedneday 7:30 PM Bethe! Cmmunity Church 7Q1 W Fter Äe(73)7752355 wwethelcwpinunityrg : ;Suday Wrhip 8:30 & 1 :00 M L Encunter Gathering:Sunday 6:00 PM 1 dwbiblestúdy49:45 M Patritqr Patl Jprden Senir date PatarPatr Rab Bukwki; Student MinitriePatr Shwn Clark Muic &WrhipPatrndy Cliftn "Chldcqravój(abljfrnJ!èrvjcè Seni&Wpmen Bible Studie içhiberthrumi ; Calfr in(otin r e the webite CHCGO Nrwd Park Lutheran ChurchELC 591 7 N Nin venue (at Nickern) (773) 6312860 Sunday SeMce10:OO M Hly Cmmunincelebrated 1 3rd Sunday Service f the Wrd n 2nd 51h Sunday Sunday Church Schl9:0O M (with Cnfirmatin Minitry) Untuffed Nurery available Sunday frm 9:451 1 :00 M Róv Rbert C Jhnn Patriyce MKiepger Directr f Muic Chifdren Sermn2nd Sunday fthe Mnth Celebriing Gad grace and mercy fr ver 86 year in ld Nrwd Park" "Our Lady Mther f the Church 8701 W Lawrence venue (773) 6253369 wwwurladymtherchurchcm lmtherchurch@alcm Ma Schedule: Weekday Mnday thrugh Friday 8:30 M Snturday5:O0 PM Sunday 8:00 9:30 &1 1 M Sunday 1 1:00 M Yung Peple liturgy f the Wrd Hly Day 8:30 M & 7:00 PM Tuedy9:0Q M Perpetual Help Nven Euchafilit dratin Firt Friday 9:00 M3:OO PM Saturday Cnfein 4:004:30 PM Baptim 2nd 4h Sunday f the Mnth Rev Richard J Kljbr?tr OurSavir LutheranChurch NrwdPark LCMS 6099 N tthçu ve (at Nickern& fld vóhbe) (773) 6311 100& (773) 311606 wwwk3 kglbálnet SundayWrhip9:OQ Schl and dult Weday fuv dvent & Lenten Wrhip Service Wednedòat7:00PM M Ste Eune Çathi Church 158 W Fóter v(773)16659 wwwtûgener Daily Mae: Mn jliúfri:6:3b& 9:00 M Sun Sat WeekejjÌ Mae:d\ 8:30 M & 5:30 PM 7:00 9:30 1 1 :30 M & 4:30 PM ««Cnfein: 4:005:00 PM Sal Bájtim: :00 PM1$&3(d Sday f thò mnth Rev Ge6rge Keune Patr; Rev Jerme Twti Rev Philip i Rdent Ptr; CHCGO t Mary f the Wd Cathlic Church 7033 N Melle (773) 7630206 wwwmwrg Saturday igil Ma 4:30 PM Sunday Mae: 7:30 9:00 10:30 M and nn Weekday Mae MnFri 6:30 and 8:00 M Cnfein Saturday 3:304: 5 PM Hly Day igil 7:30 PM Hly Day 6:30 8:00 9:00 M & 7:30 PM Rev Gregry Sackwicz Patr We have a Prechl (3 yr Old) thrugh 8th Grade Schl nd ffer wnderful prgram f Religiu Educatin fr Children and adult St Mnica Cathlic Church 5136 N Nttingham (773) 7631661 wwwtmnkachicagcm Dily Ma: Mn Weekend Mae: Saturday Fri 8:00 M 4:00 PM Suday7:30 9:00 10:30M and 12:00 PM Plih Liturgy M: Sunday Cnfein: Saturday 3:00 t 3:45 PM Baptim: 1" Saturday and 3td Sunday f the Mnth Rev Ted Schmitt Patr J :30 PM Rev ndrew zyk ciate Patal Fr Jüme OBrien n Reidence FrWilliam Hlbrk n Reidence cn!ucpar4hfmnkàchiràgç 565 St Pòu Lutherafl Çhurch : Cahfie!d6O631;(7O3) 8675O44 Rèv WàtSchehfuh wmfwfpøqknfleldrg Street teicn$itiòned SundayWrhip 8:15 &1O:45M SundaySthl & duftibible 9:3O M t SardayWrhip6:00PM StPuLukhap Chrltìañ Day Sch4l ; : &rade 8 SU4R GÇ täuçhiuye j;:j YW1E j :: è Wh4nter 3750 W Ne (773)2053787 wviwviclrywrhipnllnecm Sund Mrning Wrhip J i :00 M Wednedày Bible Sfudy 7:00 PM Friday Whi 7:30 PM Yuth Service Friday 7 30 PM Chrifpher Lewi PatçrReyRaní böríey MORTON GROE t Luke Chritian Cmmunity Church 9233 Shermer Rd (847) 9669233 ainllukeccc@bcglbalnet Rbin JneSenir Patr Jeff NelnYuth Patr Judy SmithWrhip Directr Sunday Wrhipi t3:oom Sunday Schl :OOM Wedneday 7:3OPMChir Rehearal Friday 8:00PM YuthGrup and Teen Praie Band Rehearal Praie Service Lat Sunday f each mnth Featuring ur Praie Band Mrtn Grve Cmmunity Church Prebyterian 8944 utin ve (847) 9652982 Bible Study Sunday 9:00 M Wrhip Service Sunday 10:00 M Fellwhip Sunday 1 1 :00 M dult Chir Practice Sun 9:00 M Handicapped cceible EERYONE S WELCOME NLES Lutheran Church f the Reurrectin 8450 N Shermer Rd Wile L 60714 (847) 9658210 Sundu(SetJu)19:2O M (JunóSèt) 9:30 M 1 údaytiònth 7:PJzzqperServke( (SeptJune) : : RevDr Bruce T ndern PÓthr CarlyiN Sandern Miniter t!muic i émber cngrein f!ee EvaejicaFLutheran burch in t Mihae Orthdx Church : 7313 N Waukgun Rad ;::u (847) 647898 : wywtmichaepierg SuhdayWôrhi1000M Dicder the ancient qith and ich traditin f the OhÇx Church firtchritin Church funded Byjhe Lrd Jeu Chrit andy decribed in thepage f ThuNew TetamenJday hr Ätlic dctrii wprhip àndtruciure reraain intact the NORRDGE Zin Evangelical Lutheran Church 8600 W awrence ve Sunday Wrhip 9:30 M Sunday Schól 10:35 M Yuth & dult Bible Cla Sundyl0:45M Midweek Bible Study Wedneday 10:30 M Luther Jhn Baju Patr Cmmunin ervice 3rd Sunday f évery mnth Chir practice Thurday 7:00 PM 7084533514 Fax 708 4568818 wwwzinnrridgilrg NORTHBROOK Temple BethEl 3610 Dund Rd (847) 2059982 Fx (847) 2059921 teniplebtherg Friday Shubbat Evening Service: Firt and furth FridayTraditinal Shbbat Service al 8 PM Secnd Friday Wine & Cheee receptin at 5:30 PM fllwed wiih Kubbalat Shabbat Service at 6 PM r a traditinal Shabbat Service at 7:30 PM Third Friday Family Service at 7 PM Saturday Shabbat Mrning Service: 9:30 M CaualShabbut SeÑice & TrphStúdy iqmîrditinulabbatsèñíce : :; j ntróductin t:temple frchildren p t age 6 andthejifamjfie:older blineiekòietp òrticiïe Secnd Strdy;fhththbhih at?m nndthfljjh Hdiì f thbñth at : 6 PM Sidñy HelbruncSbàir Rabbi i Jeffrey Weill taht Rabbi ictr Weiberg Rabbi Emeritu O im Huri! Car j ): pléae cá : i Neil Bqtcf9d ut " 8474867252 Change can be faxed *ther neilbtatthfrd@pineetfcalxm EDSON PRK Edin Park Luthéran Church ELC 6626 N Oliphant ve 7736319131 wwwedinparklutheranrg Sunday Mrning Wrhip Schedule Liturgical Wrhip with Hly Cmmunin 8:00 M and 9:45 M Cnteniprary Wrhip with Hly Cmmunin 11:15 M Sunday Schl age PreK thru 6 grade 9:45 M ttended Nurery fr Sunday Service Handicapped cce frm uth parking lt NRwD PRK t lban Epicpal Church 6240 Nrth vndte Nrwd Piç llini (773) 7638845 wwwaintalhanchurchcm Hly Eucharit: Sunday at 9:30 M The wmmunitie f St lban Epicpal Church and Si Richard Epicpal Church will cmbine their Hly Week ervice a fllw: Maundy Thurday gape Supper at 6:30 PM fllwed by church ervice St Richard Gd Friday ervice at 7:00 PM St lban Hly Saturday Great igil at 7:00 PM Hly Eucharit at 9:30 M S lbn Eater Sunday St lban t Richard Epicpal Church i lcated at 5101 W Devn Chicag L 60646 Ph: (773) 7744519 St llan ffer the Catechei f the Gd Shepherd Sunday chl prgram September thru May t i a Mnteribaed prgram that enriche yur child knwledge f the Hly Spirit thrugh the preentatin f Jeu parable and liturgkal element Yur child i welcme t lin u fr mrning ng at 8:45M andclaat9:oom Nrwd Park Lutheran Church(ELC) 5917 N Nina ve (atnickern) (773) 6312860 (Stieel level acceibility t niln Church) Sunday Service10:OOM (Hly Cmmunin celebrated 3Çd and 51h Sunday Servie f the Wrd 2" & 4 Sunday) Sunday Church Sthl9:OOM (With Cnfirmatin Miniiry due fr 7th and Sgróde) Nurery rm (with P hked up t Church) vailable during wrhip ervice Rev Rbert C JhnnPatr Lenten+Mldweak Service Wedndáy&1 1 ;QOM with Sup luncién fllwing (March 4 U 18 25 and pril 1) Theme: "t the CrN NRwD PR Hly weec ervice + Palm Sunday (Sunday f the Pain pril 510:00 M) Bleing and Ditributin f Palm Maundy Thurdaypril 9 2009 7:30 PM Hly Cmmunin with the Stripping f the ltar Gd Friday pril 10 2009 2:00 PM Gd Friday Liturgy (The Church will he pen fr private dnatin frm 12 Nn t 2:00 PM) The Day f Reurrectin f Jeu Chrit (Eater) Sundaypril 12 2009 Hly Cmmunin at 10:00 M Special muic and Children Sermn will be ffered T Gd bve Be ll the Glry PRK RDGE St ndrew Lutheran Church & Schl 260 H Nhwet Mghwy (847) 8236656 wwwtandrewparkridgerg Sunday Wrhip: September thrugh May 8:30 & i 1 :00 M June ugut 9:00 M Cntemprary Wrhip: Saturday 5:00 PM eper: Mnday 7:30 PM Sunday Schl & dult 9:45 M (September thru May) Chritian Day Schl PreKindergrten thru 8h Grade t Luke Lutheran Church (EL() Recnciling in Chrit Cngregalin 205 N Prpect ve (847) 8256659 wwwtlukprrg Email: ffkafukeprrg Sunday Wrhip: 8:30 & 11:00M (Schl Year) 8:30 & 10:00 M (Sunnier) Thurday Wrhip (Summer) 7:00 PM Sunday Chritian Educatin fr all age 9:45 M (Schl Year) Child Car Prvided Rev Dr Stephen M Larn Lead Patr Rev Krihna C Weber ite Patr Rev Dr Malclm Minnkk Jr Ptr Emeritu nne Krenti Organ Directr f Muic Minitrie Melinda Rameth Hailand Directr f Children Chir Nancy Oln Member Cre Crdinatr St Mury5 Epicpal Church 306 S Pipectve (847) 8234126 wvtmaryspforg Sunday Service: 8:00 & 10:00 M Wedneday Service: 9:00 M Sunday Schl & Nurery during wrhip Yuth Fellwhip The Rev Sarah D Oddertl Rectr WHERE LL RE WELCOME Check webite fr all activitie Handicap cceible C> PRK RDGE Park Ridge Prebyterian Church i 300 W Crecent ve (847) 8234135 wwwparkridgeprebyrg Sunday Wrhip 10:30 M Nurery care during ervice Children Prgramming fr ge 3 dult Educatin High Schl :15 M Rev Jame P McCracken PROSPECT HEGHTS lphnu Liguri Cathlic Church 41 1 N Wheeling Rd (847) 2557452 wwwainialphnucm Wrhip Day & Hur: MndaySaturday 8: 15 M Ma f nticipatin: 5:00 PM Saturday Sunday Mae: 8:30 & i i :00 M Patr: Rev Curti Lamben dditinal nfrmatin: Schl: Pre3 thru 8 Grade Befre & fter Sthl Care Onging Faith Frmatin Kindergarten thru 8 Grade High Schl Yuth Minitry Prgram SKOKE CderWetminter United Prebyterian Church 4950 W Pratt (847) 6734441 wwwcmupcnet Sunday Mrning Wrhip Schedule: 9:00 M Cntemprary Service 10:00 M Sunday Schl (fr all age) 11 :00 M Traditinal Service 12:00 M Fellwhip Hur Mithel Sctt Prter Senir Patr lex Wickell Directr f Yuth Minitrie Office Hur: Mn Tue & Thun 8:30 M ta 4:30 PM Central United Methdit Church 8237 Kentn venue (847) 6731311 wwwkklcenlralunkorg Sunday Wrhip 10:30 Sunday chl 9:30 M Children & dult dult Chir Practice 8:30 M Sunday Fellwhip 11:3OM12:30 PM Patr Rayerend David L Haley Chir Directr Jeph Pprawki Enzuil: SkkjiCi*trn@U1(NCP1U Yuth Chir 9:15 M Sunday cceible Church Building (% Temple Beth rael 3601 W Dernpter St 8476750951 wwwtbikkierg Likrat Shabbt/Kbbalat Shabbat firt Friday f each mnth 5:30 PM Light Nh 6:15 PM SKOKE Kabbalat Shabbat ervice Shabbat Service Friday 8:15 PM Shabbat Service Saturday 10:30 M Shabbat Ktan third Saturday f each mnth10:oom frfamilie with children under the age f five Mrning Minyan Mnday Friday 7:30 M ReRgiu Schl PrK 7h Grade Sunday 9:00 W i :00 M Hebrew Schl Grade 3 7 Sunday U:1OM12:1O PM and Wedneday 4:15 PM 6:00 PM Yuth Grup dult Educatin Kleynu lunteer Chir High Hliday Service Rabbi Mkhael Weinberg Cantr Pavai Rylman Lri B Saganin Directr f Cngregatinal Learning St Paul Lutheran Church 5201 Galitz Street (847) 6735030 webmaccm/tpaulkkia Sunday Mrning Wrhip 10:00 M Saturday Evening Wrhip 5:00 PM Fellwhip Hur Súnday 8:45 9:45 M Sunday Schl & Bible Study Cla Sunday 9:00 9:45 M Rev Matthew Cnrad Jhn Schuman Miniter f Muic Dale Lukha PK 8 cademy Principal The Church i Handicap cceible ariety f Wrhip Frmat Small Grup Minitry dult Chir & Handbfl Chir St Peter United Church f Chrit Okln Street & thramie venue (847) 6738166 wgvwtpterucckckierg Sunday Wrhip 10:00 M Sunday Schl 9:00 M (September thru May) Rev Richard Lanfrd Childcare prvided ir Cnditined Sanctuary Cngregatin Bene Shalm 4435Oaktn (847) 6773330 wwwbenehalamrg Friday 7:30 PM; Kbblat Shabbt 6:30 PM On 3" Friday f the mnth Kabbalitic Prayer/Meditatin Service 10:30 M On 2d Saturday fthe mnth Ether Knapp Religiu Schl Sunduy 9:OOM12:0O PM Hebrew Sthl Sunday 121 PM Children Mdel Sedr Sunday pril 5 10 M SKOKE Temple Family Seder Thurday pril 9 6:00 PM Rabbi Dr Dugla Gidhamer t Rabbi Shari (hen Cantnal Slit Charlene Brk Chir Directr Nna Balk nterfaith Familie Welcme ll ervice ign language and vice Handicap cceible Devar Emet Meianic Synaggue 7800 Nilevenue (847) 6749146 wwwdevaremfrg Saturdayl0:OOM Shbbat Mrning Service Wedneday 6:45 PM Midweek Religiu Studie fr dult and Yuth Wedneday 6:30 PM Club Maccabee Children Club Fr K5 Grader at Devnhire Schl in Rabbi Kirk Gliebe Devr Emet Meianic Synaggue i cmmunity f Jew wh believe and teach that Yehun (Jeu) i the Prmied Jewih Meiah Temple Judea Mizpah 8610 Nue Center Rd (847)6761566 wwwtempkjmrg Friday 8:00 PM Secnd Friday f the Mnth 7:00 PM Family Shabbt Religiu Schl Grade K7 Sunday 9:30 M 12:00 PM Hebrew Schl Grade 3 7 Tueday 4:15 5:15 PM Religiu Schl Grade B 12 Sundayll:45M1:15PM Religiu Schl PreK Tw Sunday a mnth 10:15 M Rabbi my L MemiFter Cantnal ntern Beryl Bellw Sally Gld Terry J Kane Eduaitin Directr Executive Directr dult Educatin Multifaith Familia Welcme Cmmunity Theater High Hliday & Fetival StTîmthy Lutheran Church 9000 N Kildare (847) 6761 300 wwwnimthykkilcm SundayWrhip 10:30M Chair Practice Thurday 7:30 PM Bible Study Mnday 10:00 M Yuth Chritian Educatin 10:3t1 M Rev Erik Weber Birthday Sunday 3td Sunday Sunday at feachmnth t cceible Building C>

523 26 Prgrim Raie Plnti aet pq KENLWORTH FNNCL NC 6308 1 22100 http:/4vwwkenhwffjnanclalcàm 30 yr fixed 4875 0000 $645 20% 4909 3yrfixed 4625 1000 $645 20% 4746 30 yr FH 5/1 RM 30 yr fixed l5yrfixed 5/1 RM 7/1 jumb RM (C) 626 Talctl Rd Park Ridge L 60068 Hera what the mnthty tan payment wuld be n a hme mrtgage lan uing the fllwing prgram at prevailing interet rat Cali fr Rate Call fr Rate FH and pprved Call u fr betau (B) One Oakbrk Tenace Sulle 210 Oakbrk Teiie L 60181 Call fr Rate Call fr Rate Call fr Rate Call fr Rate Lah Prgram 1 yr RM 5/1 RM 15 yr tied 30 yr fixed Rate 532% 511% 476% 523% 30 yr jumb 652% $275522 Surce: Bartkratecm :eercabi! MB6760321 PRK RwaE COMMUNTY BNK 8473849221 Mnthly Payment $91830 $89668 $128427 $90909 Prrm Rta Piflit Fit % JQWN PR THE GLEN FNNCL NC 8479010808 http://wviw TheG&nFinanclalcm 30 yr fixed 4875 0000 $700 20% 4912 3üyrfixed 4500 1000 $700 20% 4623 4500 0000 $700 20% 4564 15 yr fixed l yr fixed Thiweôk Lat week tlat year Wwwpfneerlcalcm 4500 0000 $700 20% 4591 (B) 2550 Cmpa Rd Sie D Glenview L 60026 MB 6759906 30 yr lbed 15 yr fixed 5 yr RM 476 511 518 472 512 611 570 592 Surce: Bankralecrn fr mre nlrmain viit ywjgjçg Bankrate natinal avers age ar baed n DO larget inlilulin in he tcp O market n The United Stale Mrtgage rate and refi up By Hlden Lewi Mrtgage rate held relatively teady ver (lie htt week cnfuing rule atiil hmewner cntinued t apply lr refinancing Over the lat year r Fannie Mae and Freddie Mac The benchmark 30year fixedrate mrtgage re S have been adding fee t Cmpenate fr rik Thee bai pint t 523 percent accrding t the Bankrate fee are imped n lender which then pa (hem alng COfl) natinal urvey f large lender bai pint i t brrwer nehundredtl) f percentage pint The nirtgage in The fee can add up Smene with a credit cre f tl)is week urvey had an average ttal f 047 dicunt 710 and getting a efil)ance fr 90 percent Nlie hme and Originatin pint One year ag the mrtgage index value get dinged with wa 6 i a rikbaeclpricing fie f three i percent; fur week ag it wa 5 1 9 percent qùarter f j percent r $750 Oil a $ j 00000 lan 1f The benchmark Syear fixedrate mrtgage re the hme i a cndminium that anther 4 bai pint t 476 percent The benchmark charge f 5/1 threequarter f a percentage pint 1f the adjutablerate mrtgage fell brrwer bai pint t 511 ha a hme equity line f credit add percent a fee f nehalf 01 percent lfthe lan i fr le than $100000 that The Federal Reerve ay it current plicy during anther fee f 05 percent t 5 percent f the laf) the financial crii i t keep mrtgage rate lw Fed amunt fficial have aid thi repeatedjy a recently OS n ther wrd mene with a 710 credit cre Mnday in a peech by ice Chairman Dnald Khn refinancing a $90000 laf) Oil a cnd and keeping a The effrt eem t be wrking Bankrate benchmark 1LELOC intact wuld pay rikbaed pricing fee f 25 30year fixed rate ha been under 55 percent ince the percent f the lan amunt r $2250 That beginning f February n tp f the lender riginatin charge the appraial fee and ccrding t the Mrtgage Banker ciatin fur ther ct f fíve mrtgage applicant are hmewner eeking t Snag in Obaina plan refinance with tday lw rate Jt f thee ptential Then there the Obama adminitratin Making Hme ffrdable refinancing plan which i runningint mre brrwer wind up deeply frutrated by high fee and t; ur4/li 2ln i liii lan n l:(;r): (l urrwxc ii 5i Juni? iui ru wdn J u LJJS uf 3 riaxì k lui i» e i cii Ct lk lude ii iuiiaui i/r Ti n wiitait»i kk b 3(1 U) irnal ; i i ) nur! j )l t L tci r; hii 2t )iiiic i urc S ak 4t1) c 4wt1 wi luii uitit ii iii i uit itt ilkin tic ft t ulj i 1 U4C ljc itiiiì t N )Pt Biirìc i i iii Hi $t i ii a i»1 i jul Tl 41 )l ui1sulì1 jh b hic tilih) li t(c 1 4i( S lt 411) tijti;jn \uuì)s Siir Ctai i i Ltuuiij Ì lla ;arlg ll lin ic a) j rc t n hi hic li Jft Ckinj OLLSS i Sii7m t4l tria n lud >en iç Lii! rinc liii i LlJLi )4?Ur kmkrthvay ci&nntj /J4 JlC lflt) )C 1 fl Jafrie J? COU J iwrji 11th Jbk LMJ 800wlan 1 tepr u ij3arrjjtjkjr till HS$5$J9443b Jiflp:/4jtFJlJ1trtjl(W Prlrm THURSDY PRL 30 2009 UNTED HOME LONS 7085318317 htp://wavwuhlan 30 yr fixed Call fr Rate 5/1 jumb RM Call fr Rate 711 jumb RM Call fr Rate 10/1 jumb RM Call fr Rate Fr a pernal qute call Mike Dulla Preident (B) 3 WeibrDk Crp Center Wetcheter L 60154 MB000647g THRD COST MORTOGE LLC 8478498800 GLENEW STTE BNK 8477291900 htp://wwwgbciyn 30yrfixed 4875 0000 $1500 20% 4955 30yrfixed 5125 00Ì30 $1035 20% 5181 5/1 jumb RM 4375 0000 $1500 20% 4433 5/1 RM 5625 0000 $1035 20% 4151 511 juinbrm (interet n) 4625 0000 $1500 20% 4365 7/1 RM 5625 0000 $1035 20% 4454 7/1 jumb RM 4875 0000 $1500 20% 4671 15 yr fixed 4625 0000 $1035 20% 4720 Stuart L Chen at 8475805555 r chen@3rdcatmrtgagecm Retrictin apply pleae inquire (B) 3100 Dundee Rad Ste 406 Wrthbrk L 60062 60777 (C) 800 Waukegan Rd Glenview il 60025 LENDERS TO PRTCPTE N THS FETURE CLL BNKRTE1COM SLES DEPRTMENT @ 8005094636 S)ag tufi) l pair f ilk tcking in a thitle patch The prblem eem t be a lack f cmn)unicatin afl101)g lender mrtgage inurance cn)panic Fannie Mae and Fredchie Mac and the federal gvernment Cae in pint: Brrwer with mrtgage inurance ate being tld that they cant refinance yet under t)e Making Hme ffrdable plan Bank f merica (and Cuntrywide which Bl jut abrbed) ay it will refinance hme 1001)5 UlUler the Obarna pian iii tw phae: firt the withut mrtgage inurance and later the with mrtgage inurance Cutmer f Well Farg ay they are tld mething imilar Bank f merica pkewmaj) ay the bank i refinancing lan n tw phae becaue the mrtgage inurance cmpanie have nt implemented the Obama pial) yet Meanwhile it nt clear that emplyee f Fannie Mae and Freddie Mac are aware that big bahk are refinancing lan ii phae depending n whether the lan have mrtgage inurance nd me nurtgage brker init that lan with mrtgage inurance will tiever be refinanced under the Obama plan nd n ne in tue federal gvernment eemt want t Step up and rectify the cnfuin iil; 11 ts l lii c (lw iiitl iic lwl c LMO J \SL i $%tçkk li lu» }uu1to ir:i itiç itou1 (R iiiipk UtJ l e cilcut ciuç ítiiie (i lu l 114 h iii liii hi ll ri i wi liii in i lin ti ulpl t Llu$v llou lilt tle [liiikiic in hj u i ti Clii ;C hit tun lìi il ji n ii jiil çiakìc WC enpitiricul liai >ai CLENDRS TODY Baeball Deerileld at Maine Eat 4:45 pm; New Trier at Maine Suth 4:30 pm Gymnatc: Maine Eat Maine Suth at c1 eat 10 am tacre Nrthide at Ntre Dame 5 pm Sccer Maine Wet at Maine Eat 4:45 pm Sftbalf Maine Eat at Highland Par 4:45 pin: Maine Suth at NOe Wet 4:45 pm Tenni: Maine Eat at Maine Wet 4:30 pm (vantn a Maine Suth 4:30 pm; St : : Jeph at Ntre Dame 4:30 pm lleyball Maine Eat t Deertield 6:30 pni:waukegan at Maine Suth 6 pm; Nazareth at Ntre Dame 5 pm ftater pet: Maine Eat (by/girl)at ; Rithard 5 pm: Herey atmainesptli 1lju) 4:30 p m FRDY Badmintn: Maine Eat Maiñe Suth at CSL real at Evantn 4:30 pm Baebalt St iatr at Maine Eat 4:30 pm ttvi Titel at Ntre Dame 4:30 pm Sccer Maine Sth at Gtenwd invite TB Sftbafl Mama Suth at St Charte Eat in vile 4:30 pm T9ck Maine Eat tby) at Prpect invite 4 30 p in : Maine Eat (girl) at Elk Grve $n vtte 430 pm; Maine Suth (by) atgienbrk Nrth 4 pm: Maine Suth (girl) at [1k Grve 4:30 pm Heyba Maine Suth at Dwner Grve Suth invit 5 pm STURDY Dadmintn: Maine Eat Maine Suth at CS meet at Evantn 9 am Daebalt: Nit Wet at Maine Eat (OH) 1:30 pm; Maine Suth at Highland Park (DH) 1:30 pnr Manan Cathlic at Ntre Dame (D) 10 am lacre: St Rita at Ntre Dame 11 am Stthall Maine Eat at Wheeling (DH) l am Maine Suth at St Charle Eat invite O arm Tenni Maine Eat at Prvi Wet invite 9 am; Maine Suth at Gtenbrk Suth 8 am lleybalt: Maine Suth at Dwner Grve Suth invite 9 am Water pl: St Charte Nrth ai Maine Suth (girl) am MONDY Baeball: Carmel at Maine Suth 4:30 pm Sccer Regina at Maine Eat 4:45 pm; Maine Suth at Warren 4:45 pm Sftball: Maine Suth at Waukegan 4:45 pm Tenni: Nrth Shre Cuntry Day at Maine Suth 4:30 pm Track: Maine Eat (girl) at Maine Wet 1n vite 4:30 pen Water pl; Et Grve at Maine Eat lbyfqirt) 5 pm: Gfenbrk Nrth at Maine Suth (by/girl) 5 pm TUESDY PGE 27 Baehalt Maine Wet at Maine Eat 4:45 pm ; Glenbrk Suth at Maine Suth 4:30 pm Sccer; Maine Eat at Deerfield T pm; Nife Wet at Maine Suth 4:45 pm Stbaif Nue Nrth at Maine Eat 4:45 pm Tenni: Deertield at Maine Eat 4:30 pm; Maine Suth at New Trier 4:30 pm; Ntre Darne at Mait 4:30 pm Track Maine Suth (by) at Glenbrk Snutli 4:30 pen lleyball Glenbrgt Nrth at Maine Et 6 pm; Maine Suth at Glenbrk Suth 6 pm lilariart Cathlic at Ntre Dame 5 pm Water pl: Maine Eat (by) at ernn hill pen Eat get n earn N 5 ee iii éctii1 By MTT HRNESS mharne pineerf cal crn itji: POLOLnan effrt í imprve hi team defene Maine Eat by water pl cach Sctt Guilfil changed hi ffene: Tired fwatehing the Demn getbeat in ttantin Guil!il reärranged hi pdi frmatin t ; give the player a bettet chance fwimrning back int pitin The team 42 win ver Wheel ng n pril 9 gave Guilfil a glimpe f the Demn plential "That wa a defining mment" aid Guilfil whe team wa reegnized bylllplcm that week "Our cnfidence level really went up and we realized what we ate capable fding! Matt Wiege! Danny Ward and Steven Tm ali are intrumental in the team new tranitin y tern Wiege! wrk a the pint n ffene and ften guard the ppitin bet player a the hle defender Ward and Tm al are taked with hutling back t et up the defene Eat hwed the Wheeling win WaSt)t a fluke The fllwing week the Demn beat ti Steuben 9 7 The ptil 14 victry wa the prgram firt againt the Panther Depite falling t Highland Park 95 n ptil 21 the l)emn fil) ihed the CSL chedule pril 23 with a 173win ver Deerfield Eat entered the week 49 verall and 25 in the cnference "Weve beet) getting better" Guilfil aid "We are hitting n mre cylinder" Eight player cred in the Deerfield win Danny Ward cted fur while Mike Mazur added three Chri Scanln the team leading crer wa ne f fur t cre twice He came int tte yeek with 37 gal The night f the victry the Demn learned their ppnent at the Fenwick Sectinal The N 5 eed drew N 4 St Patrick fr the May 14 quarterlinals Maine Suth the N 8 eed pen with N i Fenwiek lllplcms tp team and furtime defending tette champin "We ate rights where we belng" Cuilfil aid (rl)at the eed puhed fr and we are happy with it Drawing St Patrick thugh CncT: Rich Martin Managing Editr p: 8474867481 e: rmartin@pineerlcalcm Michael Mawr (right) fund the net three time lat week durin Maine Eat ll3 victry ver Deerfietd (Jel lerner/staif Phtqrapher) i tugh ihey ate theie with Oak ParkRiver Fret and Yrk in the tiet belw Fenwick" flut Eat firt cmpete in the CSL turnament which tart May B at Evantn Glebrk Suth came int the week undefeated in the league but the eeding and pairing had yet t be determined Mnday The Hawk wrapped up the weekend l5 in the CSL and 213 verall GmLS: Eat and Suth partieipate in the CSL turnament att Glenbrk SQuth beginning May 8 Bth team al are at the Fenwick Sectinal Flue 1)emn arc the N (i eed and play Oak Park River Fret n May 13 while the Hawk are N 7 and take n Yrk the ame day Cmiacez t: pivaeerlealcm

DameSt Dame \ 281 By DN SHLP4 dhahn@pineerlcalcm TRCK Ntre Dame High Schl Matt Bacm may nqt have the typical hurdler build but the enir ha hardly been held back by a lack f ize t Friday Dn Relay Bacrn wn the 110meter high hurdie (144) etting a chl recrd in theprce 1le wa cming ff a victry the previu week at the cmpetitive Bartlett nvite which included!tate pwerhue like Thrnridge and me quality prgram frm Wienin "He wn that meet and everybdy urrunding him wa like a ft ta)lez and he ge ut and ND head cach Mike aid (L Dn Relay)&did the ame thing TkaL tethmentt hòw hard he wôrked ver ftiyéar He wrked really hard t be gd at r David ftebda and Ntre Dame beat St Patrick 5O Friday (Brian alenin/saft Phtgrapher) what he de m really prud fhim" Bacm wrklad at the ND meet wa hardly an eay ne He went frm the 110 high hurdle t the middle ditance relay (4th 3:543) t the lwhurdle huttle (5th 1:025) with barely a m ment t catch hi breath He later participated in the team 16Q0 relay (6th 3:5510) ining l3acm ii the event were the like f Greg eifel Mike ngelini Jack Mcpdrew Tyler Taugney Mike Ca k and TimCurley Mcndrew a phmre had a fine day in the field F14 came in ixth in the lngjump (18feet 11) and ixth in the highjump (5 (3) Ṡenir lp Englih came in fifth in the hbtjút (449) but cratched in th dicu He kept making thrw that were rightóutidethe ectr line think it wa becaue f the ønje!rb!*v lûrîuzi Utiq wwwyureancm THURDY PRL30 2009 Ti: Dnbrcak bread ivitli hamrèk after mátch By DN SHLN dhalin@pineerlcalcm wind" Jankwki aid While the wind wa a drawback in the thrw it aided cveral f the runner a meet recrd were et in the 400 relay 100 middle ditance relay 800 triplejump and 1600 relay "We had a lt f recrd br ken tday fr the relay think the wind might have helped a lita tie epecially in the 100 (wn by Nile Wet enir ChrìWrlght/ in 105)"Jankwkt aid : The Dn wre cheduled ty2 viit Jliet Cafhjic earlierthi week wherethéy will facdtlt hhietwn HilltÓir an Nazareth ND then ha three traight meet in Lile They wifl facp Benet and St iatr at Benet n May 5 cmpete in the Ciirliii Nalley Jnvitett13eñedictine Unt verity n May 9 and then re turntbeediétir lbrthe:escc Cnference Meet n May 14 Cimncnt: pineer!calcìn TENNS The Ntre Patrick rivalry i a fierce ne thugh it i a bit mre f a laidback affair n the tenni curt than n the ftball field r baketball hardwd The Dn defeated the Shamrck 50 in tenni Friday in Chicag But the afternn didnt feature pping tudent ectin yelling inult at ne anther ntead it wa jutgentlemanly matche f ingle and duble When it wa ver the team had a ckut "We ck ut nce r twice a ean and invite the ret f ur tudent t watch the game (and enjy the fd)" ND head cach Steve Jankwki aid "We uually d it during ur hme match with St Patrick But we played them n the rad thi yea and the St Patrick kid verc lking frward t (ril!ing) S we cked at their place They prvíded the drink and nack and we brught the ht dg" ND mut have enjyed the ptgame tailgate a little mre than the Shamrck did after a cnvincing vietry Leading the way fr the Dn wa David 1lebda wh wn 61 61 at firt ingle The kid really lk up t ilebda" Jankwki aid "He i the heart and ul f the team They rally behind him and he keep them in line" Teammate Rnnie Wing a trickht artit wh remain undefeated wa a 6 0 62 winner at ecnd ingle Gin Recehia and Kyle Smith were tp in firt duble Jhn and Je Kalkwki wn ecnd dubie and Tm Crwley and Jack Smith prevailed at N 3 duble Ntre Dame ha been playing me inpired tenfi recently ND fllwed up a Nue Wet nvite title pril 11 with dualmeet win ver defending ESCC champ St iatr Maine Eat and Nazareth n the tuneup befre facing rival St Patrick the Dn drpped a 43 d ciin tundefeated Carmel pril 23 "Were cranking That wa a gd week" Jankwki aid The Dn were cheduled t viit Benet n Tueday They return hme t face St Jeph at 4 pm tday at Nrtheat Park in Park Ridge ND tudent and teacher are invited t attend Ht dg will be prvided " buy the fd n my wn dime They jut have t cme ut and upprt the team" Jankwki aid " have 160 ht dg and m ready t g" Bacm et Ntre Dame recrd in 110 high hurdle : "e C ç LC r Jack Mcndrew l Ntre take ff in the lng jump final where he plated ixth during the 43rd Dn Re lay (llen : Kleta/Fr STN) " t PONZ(R PRESS PtMJCUUN LJ11JJS prt n Phelp nt wrried after ND l t Lane Tech By DN SHLN dhalin@pineerlocalcom LCROSSE Thugh the Ntre Darne lacre team caine up n the hrt end f a li2 game pril 23 againt viiting Lane Tech Dn head (Ol1h Sam Phelp wa nt alaruicd "1 think ur playwa better Uìuii the cte" aid Phelp lu)sc CilU1 entered thi week íth 35 recrd The cach aid hi team flislthj)s were cmmn and turrectable and that he aw eeial trng imprvement 110111 hi inexperienced quad lhlll)s aid hi team mitake were in area like midli(l(l pesion midfield detei4e grund ball paing and giveandge in frnt f liii gal \\Then the Dn did get Weekly Maintenance Spring/Fall Cleanup Shrub Trimming Tp Sil& Seeding Shrub Remval! ntall*tjn themelve pen in frnt f the net their ht were t ften fftarget "nther ne fthe thing we have t wrk n i ht ng" Phelp aid "That ne f ur weak pt Weve wrked n it bu it jut a matter fdrill drill and practice That ne fthe thing we knw we need t wrk n" The ndian et the tne early in the game by cring in the firt minute Lane led 2 O after ne quarter and were ahead 40 when NDS Ben Peerar fund the net with jut le than even minute remaining befre halftime The Dn urrendered the next five gal but ND eemed t catch a ecnd wind late in the game t lid furthquarte r play wa rewarded with a Rb Neyln trike with five minute re Perfect Turf Landcaping nc 1692 S River Rad De Pial jic Family wned & perated Cmplete Cutm Landcaping Service ft 8473180943 Redential & Cmmercial bvi lricci Fully nurcd lree EilmaiN (call Stev rgcrel eratin Sd ntallatin Mulching Drainage Sytem NOTCE OF NONDSCRMNTON POLCY S TO STUDENTS The Child Care With Cnfidence nc chl admit tudent f any race clr natinal and ethnic rigin t all the right prgram and privilege accredited r made available tudent f the chl t de nt dicriminate n the bai f race clr natinal r ethnic rigin n adminitratin f it educatin plicie admiin pi1 cie chlarhip and lan prgram and athletic and ther chl adminitered prgram Child Care With Cnfidence Publhed n Pineer Pra 4/00/09 (t688050) 32 maining The gal came after a timeut in which a play wa drawn up pecifically fr Neyln "We ran the ilatin play and it wrked pretty well" Phelp aid "We ilated him n the refraining line and had the remaining middie 80cl attack crah the net and hield the galie (Neyln) beat hi vin the ther guy brke ut and e luid a layup" On Saturday the Dn managed t play ne and half game in the Deerlieid Turmiment befre the ret i the invite wa wahed ut by rain Deerfield defeated the Dn 72 in the pener Neyln and Harry Jhnn cted the gal fr ND Ntre Dame wa leading Tait 51 when the game wa ealledjut befre halftime Cntinent: pinccrlcalcìn Night f Re 2009 Hnree Hepu celebrate ur Hme Grwn Succe Saturday pril 25 2009 Dinner Ticket $45 Preented by: Nue Chamber f \ Cmmerce &ndutry Buine f the Year ccunting Firm fflwniniak Piper and Cmpany Bb Wrdel LivnØ Legend Elaine Heizcn Cach f the Year Patti Rerwr Dynamic Parent lunteer David Beicrualte Fire Fighter "Ht Spt" Martin C Feld Ken Scheel Chamber Member f the Year Bb Ryan Mlle Citizen f the Year Bernadette Knaplk Fih Nib Glden Senir Mar/jane Thipina Nue 600d Neighbr Mary Mahney Plice Officer "Special gent" iric ambrech: Teacher f the Year Jy Pa rii Unung Wrker "Nt Enugh Hur n the Day" Jhn lekt Yuth f the Year Matthew Bardela Call Brenda t RSP(847) 2688180 Ntre Dame Harry Jhnn (1) trie t evade lane Tech defender during a 92 l t the ndian n prii 23 (C Jan Brwn/Fr SNG) \\ RUSH DERMTOLOGY jr Skkie WelcOme NewDermatgt Stateftheart dermatlgy ffering cmprehenive kin ervice frm infancy thrugh adulthd claencew Brwn r MO Ore(r MOHS Dernarc Surgery Bardectifred Dermrkrgir Skin cancer treatment CSmetic Service TO SCHEDULE N PPONTMENT PLESE CLL (847) 5689911 471 1 Wet Glf Rad Surte 71 1 Sklrie llini Hur by appintment with weekend availability Cnveniently lcated near Old Orchard Shpping Mall Mt inurance plan accepted ddirlnal pplntrnenl Lcatn fr RUSH Dermatlgy SU5H Dernaiig 1725 W HaO\ Sie 264 Chcgr nu 312? 6422195 RUSH Demii99 6319 S Suie 02 Wet 6nr 1630) 9645OO www ruh idni rl i n S9clua H Barba MD MPH irani Prfer Bard «irfred Dennrrarfgrt Treatnient f kin hair and nail dieaé RuH t*uaihøq1 610 5 6611 501 3900 Oak Pak 6000 1312)9412195 f nj f ff1

3Oiprt ìwwyuíeañcm THJRSDY PRL 30 2009 Blùè Dèñiiii frugglc withut enir t aller By ROB LENTN Cntributr BSEBLL Miing tw f il ceryday enit aitìe 1at ciiciti rc1 a tugh eek a t (h0p1)e(j j)i ui (()l1)t?flct gatie t (1 (len )look Nrth and a nncnfercnce hwdwn wi th Cnant "Were playing a little light right nw" aid Blue Demn cach Dan Dlney ere withut tw tarter right nw it difficult ihe pitive i the junir are getting a chance t get in there ìind )ia varity baeball Catcher )an \itlui ha been ut with a prained ankle and pitcher/utlïelder Danny Walker i n the bench with a tweaked hiíi dei Withjut three ther enir n the quad it wa an exceptinally difficult week Maine Eat (610 13 CLS Nrth) tumbled pril 23 t Glenbrk Nrth 147 The Blue Demn fell behind early and fught back t By ROB LENTN Cntributr SOFTBLL Maine Eat Reilly haek culdnt have been mre excited lat year a he prepared fr her frehman ean haek wa ging t be a tarting third baeman fr the Blue Demn and he wa planning n making an immediate cntributin Then the unthinkable happened haek had me pain in her knee and went t the dctr where they diagned her with a genetic injury: Part fthe bnein her knee want getting bld and he needed urgery putting an end t her ean afterjut ne game "When fund ut wanted t burt int tear" haek àid "Sftball i my favrite pòrt and wa devatated wa really excited t play be Maine Eat Crey Evan (left) and Derek Hward fight the un a they track up ppup Thurday during the Blue Demn 141 l at Glenbrk Nrth (llin William/Staff Phtgrapher) within 107 befre the Spartan cled the dr "We are hitting the ball pretty well thi ean" Dla mey aid "Were hitting 275 but unfrtunately the tw guy we were miing are tw fur tp hitter! Maine Eat truggled the next tw day a they were hammered Friday by Glenbrk Nrth 112 and Satur (lay by Cnant 183 4We till have t wrk n making adjutment a t vluit were ding \v1ng" l)ulney u id lo flt playing gd íuhinieiital i ):ts1t)l) \nd it t till that w1& \\)king 0)11 weekly \c uivc t d hat ve practice" Dlney aid he think hi tarterjut need t play with a little mre cnfidence bright pt wa juni! l Nagde With \itku n the bench Nagde tepped in behind the plate and did a lid jb Een niie in pessiel3 ii hwed me f))}) n hi bat ging (ifar 12 in the threegame pan "1le wa aked to) d a littie if101e and he did an excellcntjb" Dlney aid "Hpefully he can cntinue that Thinglkgd if we get the guy back We can make a gd puh at the end" Dfney aid he i hping that hi ther three enir can take a cue frm Nagde and tep up fenir lex Czubak (pitcher/firt bae) Derek Hward (pitcher/utfielder) and Chri Ripj)e (pitchcr/utfielder) can l)u1 the teaiu n their htiklei they i:jut 1)1 abk t ld 11101e \1fl fr the pitching tall they had been having a P1Ctty gd ean befre th( etback lat week Ripple ha been very cnitent Dlney aid but he need me help frm hi teammate "Every time he ge ut he battle and give u a ht t win the game" ) ney aid "We jut havent played very gd defene Our defene hant been there every game and we need t be a cmplete team" The Blue Demn have a buy week ahead Maine Eat wa cheduled t trayel t Deerfield n Tueday ht Deerfield tday travel t St iatr n Friday and ht Nue Wet n Saturday Cmi:ent:pineerlcalcwn Team atmòphcre pay ff a Eat find Ucce caue went thrugh all the Tean wrkut" While haek culdnt even take batting practice he remained dedicated t the team ging t ll the practice and game Thatmight have made thing even wre a he had t watch Maine Eat win jut ne game all ean "1 dnt even knw what wrd t ue t decribe lat year" haek aid "t painful tjut it there and watch them le becaue there wa nthing culd d t help them" While lat year may have been unbearable thi pring ha brught a rebirth fr haek and Maine Eat The Blue Demn have already racked up fur win thi ean and 1iityear head cach Mike Bender ha increaed (he number fgirl in the prgram frm 21 t 3G We came in with a brand new philphy" Lender aid "We hadnt had much ucce a a prgram and the firt gal wa t build a team atmphere We had trip tgether and we did a lckin and it really paid lf" Maine Eat regitered early ean win ver n Steuben and Prvi Wet while weeping Prvi Eat in a dubleheader But what may be even mre impreie i hw the Blue Demn are handling thefl)sccs in cnference play The Blue )enin had Nile Nrth againt the rpe befre drpping a 32 deciin in extra inning rhey al drpped a cle 52 cntet t Highland Park "We et a lt fgal but the real gal wa t cmpete n every game" Bender aid "Weve run int rad bump thi year but nw ie have the ability t cmpete Were nt ued t winning ball game Were able L get lead but flw we have t learn hw t finih" fter nt eeing live pitching fr almt a year haek ha truggled a bit at the plate but he been lid in the field Meanwhilejunir Jenny Krawice ha been the team mt cnitent hitter with a batting average arund 400 "Were cming ut and putting up a fight thi year; it ally exciting" Krawiec aid "f wejut try we can amunt t anything we want" Other key cntributr thi ean have been catcher Mary Caruvana pitcher Michele Perche Sam Dek and Cara DeBenedicti firt baeman Jeie Demar and ecnd baeman Kyla Stancy Maine Eat i cheduled t travel t Highland Park Thurday and Wheeling n Saturday Crnrnent:pinecrlcaLcg Maine Eat center fielder Reily haek cre the plate during the Demn win ver n Steuben (Jerry Daliege/fr SNG) PONEER PRESS PUBLCTON Super phne fr uper mm Hurry in tday and get great gift fr Mm MOTOW755 : erizn Wirele 3G Excluive Sleek muc phne with external tuch cntrl NOW l$t99 ONLY $8O992ytptce*$SOfluiWflrelSttdebtOaFd ll phnerequlie new2yr actlyatldn WSleupplleS h rv u i i i " intrducing Friend& Fa y Nw yu can call mre nd ave mre BlackBerry Curve" Keep in tuch n the g with email and Web acce $9999 $16999 2yr pace $70 maiiin rebate debitcard t n extra ct yu can get Unlimited calling t yur tp 10 number and ur 80 milln cutmer lt the bet value in wirele! l400ny6me Minute r mre (ctivatn fee tane and ther charge apply) ncluded with any Natlnwfae Family SharePlan with Switch t merlc& Larget and Mt Reliable Wirele NetwrK Call i 8772BUYZW ERZON WRELESS COMMUNCTONS STORES where indicated) Call lt Mre tur ll lited lcatin are pen n Sunday (except DDSON NEWS 1801 WLalreSt 6309l68046* RLNGTON HEGHTS 138 E Rand Rd 8472530329 * UROR 740 N Re 59 6308512254 * BT 350 Randall Rd 6307612160 * BELDERE 1 91 2 Gateway Center Dr 8155479493 BLOOMNGDLE Stratfrd Square Mall 6305824707 336 W rmy Tral Rd 63098OE4322 * BOLNGBROOK 224 Weber Rd 6302264660 697 E Bughtn Rd 6307838966 * BOURBONNS Ntthfield Square Mall 81 59367605 BRDLEY 840 Kinzie ve8159290693 CLUMET CTY 1245 Trrerrce ve 7088620500 CHCGO NORTH 6451 W Diverey 77383f4401 * 1652 N Milwaukee ve 7734896200 * 3620 W wing Park Rd 7734635366 * 4265 N Harlem ve 7084571 377 * BO W Nrth 7m 31 23975800 CHCGO SOUTH 120 W 87th St 7739949100 * 3435 W 26th St 7735229300 CHCGO CTY 500 W Madin 3128310127" * 500 N Mchgan ve 3 124641390 * 209 S LaSalle St 3126583900" aw 36 State St 3127268277 * CHCGO RDGE Chcag Ridge Mall 7083469557 * CRESTWOOD 1 3447 S Cicer ve 7083969822 * CRYSTL LKE 1 125 Suth Rute 31 8154446080 DOWNERS GROE 1404 tutterfielcl Rd 6309S380S2 GURNEE6543 Grand ve 8478556019* wt Gurnee Mill Mall 847866181 * HLLSDE 2201 S Wlf Rd 7089472500 * HODGKNS 9402 Jlie! Rd 7083870554 HOFFMN ESTTES 2734 N Suttn Rd 8476650190 * JOLET 3330 Mall Lp Dr 81439S100 ClabratiOOWirtr lcatelluceflt wwwpineerlcalcm Click veriznwirelecom LKE N THE HLLS 290 N Randall d 8474582865S LKEZURCH c(mlgnl LNCOLNWOOD Unclitwd Mall 7S68 554 * MTTESON 4063 2) lib Sr 7Û87487444 MCHENRY Nw 3501 Diamnd Dr 8153442177 MERRLLLLE N 401 W Slat ve 2197368400 2109 Sutltlake Mall 2197567440 MT PROSPECT 1 W land Rd 8472592627 * NPERLLE E Ogden ve 6304203299 NEW LENOX 847967 1 1 50 * NuES 9635 N Milwaukee ve 5700 W Tuhy ve 8476477724 * Glf Mill Mall 8472983847 NORTHBROOK NrthbrOak Curt 8475098527 235 Skkie Oled 8472727770 NORTH UR0q 1 852 Twne Center Dr 6309072055 * NORTH RERSDE Nrth Riveride Park Plaza 7084420755 * 0RLND PRK 92&1 W t 59lh St 7084038200 * Orland Square Mall 7084033l22 PLTNE 784 E Dundee Rd 84793481 1 3 plh4felo 12632 S lite 598154367388 * SCHUMURG l249e:hiciqin Rd 8473306010 wdrield Mall 817619 0773 SOUTH ELGN 596 Randall Rd 8476951607 * ST CHRLES 24 S Kirk Rd 6305 1 35326 * ERNON HLLS 701 N Milwaukee ve 8472172300 * WEST DUNDEE Spninghill Mall 84742&2 177 WHETON 109WGelreva ltd 630 6682199 WHEELNG 1538 E Lake Ck Rd 8472158788 * WLLOWBROOK 1450 Kingey W3/ 6308872944 U5NCSTO 18004994249 d7wiree 1G en2 erizn Wirele 3G Excluive Open t reveal a full QWERTY keybard fr upereay textlng j$4999 $w99zytprlc SSO mal4fl rebate debltcard PUS buy any BlackBerryget ne FREE! ll phne requre a vice planwlth email feature r email plaa Free BlackBerry nfegual er tener value UTHORZED RETLERS Equipment price mdel return plicy vary additinal eqiprnert elated charge by lcatin uthrized Retailer may mpe including cancellatin fee RLNGTON HTS lte Cellular Cnnectin 847255?222 BRTLETT Wirele Millennium Ctrinrunicatin ó304835050 ELMHUR5T The Cellular Cnnectin 630834 27/6 ENSTON Nrth ShteWirele5 84/7330700 GLENEW Nttft Sirte wrele 817729 6100 JOLETÌhe Cellular Cnnectin 8158382900 LKEBLUFFTOWerWrelcl7SS71 168 LKE ZURCH Crprate Cellular 8475404440 NORTHUROOK Nrth Shte Wirele 8472918855 NORTH CHCGO Nrth Sirre Wirele 847689 8101 OK LWN lre Cellular Cnnectrn 7084994088 ROUND LKE BECH The Cellular Cnnectin 8475485890 SKOKE Nrth Shre Wirele 8476735803 WUCOND Waucnda Cellular 8474870400 WLMETTE Linear Cmmunicatin 8478533500 HBLMOS ESPÑOL iit any tre gvt tac & ur urdargu culd dd 7! RegulatrY & 85C dmittet/flh/m0 & ther by area) r net taue (ditail: 1BU6841U); telecm harget (vade qurterly) 113% f ntertat & ntl Our Surcharge (lti Fed Unv SC f hareplfl ew/21imtt) chargeapply urdata tenter ietelyed friend & Fairiily; Qtydmellc $35 ($25 frtendifl Family termlatlalee/tl6 upt4!/ml aftratlwance & add landlnerwitete 9%33St0 yinblll ctvatn fei/le frm& tredil apprval Lp l $tlsearfy et up & maagemy enzan Offert cveeage (ui *9ml (altig Plan rebate hare the ame frlend& Family number p tacwuntt eligiblitylimit; numbet) ndudd alt eligible been an auouot MM MPORTNT CONSUMiR NORMT0N:ublecttu nutlrbetsor(uttomet0wn5bdb05t01 culte mall Ouet uppllenlat Rebate debit curd take up 6wk & cup l U nut O2009ett100 Wirele number (utherthadltectotyatltlaflbe 900 LlmltedtlmeOfettWh Netwuib detail & cverage maptatvlw(0m varying by vc Ct avallabteevetywhete

S S 32 wwwplneerlcalcm THURSDY PRL 30 2009 RELTOR l a t ; r_ux Outtanding gent Outtanding Reult ṡm Thinking f SELLiNG Yur Hme? The Number One Selling R1 Office in Skkie Since 1986" Serving the Entire Nrth Shre Cati fr a Free Market nalyi! 8476749797 Ead Ottic lndepemdeny Owned & Operated Clin dina Gnzalez Cen Barry Bnveni e Clrlr hld twnhue n tabuln cnthtln! Spaciu vaulted liv an w/ky lght Gd ze tanaily Fm kylilrl in balli ra ll newer appliance LarB bachyarö pali wilh trage ted CREDÌ l buyer tr carpeting Mtivated eller! $229900 New cnd cnverin cbhievabt lcatin t a great pnlcel Spaciu 2 bed/ batti n unit watvdryer Ceniral ar/heath New pacu atn kill Marble/late batti w/jacuzzi tub ree utdr parking pt ncluded in price Price vary per mit pleae call Tire bet deal in twn Larg 4 bed 25 bat pinh level hme w/rare tinited nbbm lii lrnnmraculate crnbhbn Hrdvvd tlrìng ltirgtrut Spaciu tanrily rira w/brick tireimlace & wet bar Prteinahly ladcaped yard w/nature tree $499000 LNCQLNWOOD Ctianning well built paciu cehcr enlry brick lnial hme Lving rira w/hrrcplace K eperb rma dining rn htardwd blm Main tin tan rm wihireplace Nice ize hnnhche lading t cvered eck leí enierhamning Feihenh recrealrn rem W alla & hwer blue in very gd cndiliunl ll brick jumb blev n great area 3 br 25 balli llahiy redne Tna 01 new update 2nd kitchen in lwer level & tul balla w/whnirlpl Open huge r w/hnw t lt f wndw et emniry Frmal dining rari $420000 Peler Knten Jina Kni Peler Kna 6303274434 Jim KOntOS 6303279136 Sain Traka 8479218681 David Braun 8476862000 Marin Dan 3122086034 Cynac Lithe Din Baka Mairie; Gr Otitlaiiing Curi int lwnhme nv cirlrcliii n/many upprade Kil w/42 maple cabrdiry granite cinipa & S S OppO Furrai ibirinig rm Mater halb trill Englih bun alt 2 1/2 car gar lw arnrrt Highly deirable mld ut develpment $3490DB Originral Owner Stayer cte burl alin 20ml Flr cnd rar a greah lcairrm WahRung dnhnice J ld rchard trvppiing cnnrier bmmck trlevel wfcaihredral ceiling im nvmmmçj mmmmldimnnrig mvi Sel) ak uon laririly mn tul hrarprt Tenute h hrwg4 greah clml balla laaimiry/uiilmly urp pmp ll garag Eatn kiclien bahtn rl w/mhbi iark hnarmhwmh & cement ide drrel trame pride 01 wnerhip tlr prvaie hndlcrly epoed bnck wall $329000 L h del ierage S145000 ery pacnnn hwuhrnmim willi pera hivinag & dinninig mann licr brian Bamghnt eew wirmnbw Hardwd & ceranmic hile r Flihned lwer level w/hull ball laundry an & trage N rrrmmlhmly amt Plenty h parking $235K lvely linne willi rich arctiiteclral nhetail Tw try entry wnhtn circular larcae Sky gl hhmrghnuh Grannle tir Brand mew kntcbren Many tabuln nupciale rant t ee $899000 lar li ç" Harri li 8473226277 Dn Keenan 8476749797 Dan Firiar 7735433500 Elizabeth Linday 8476303796 Cyriac Luke 8478772670 Sit ine Dakaialnn Sann TriaRa Jan Hrian 2 bedrm t alr crad n lire 2004 carl cilvcrrii Great hiicaiin large clei & larg jaaii Cle i liar tie arl tliway Uiigraded lightinrg parking (2 inace ti it cnd) ncr trage & lnely 15001 nirnit ee t 0aalaki 8472277675 3 bdmni 2 bli hiilwd r hlrriglnlnl Skyhigl & narble en lica Bmazrlian rpie le; Tw iennrdeleil balli rum granile cnlrlp in brrir whiralynel nicely deceralemi n ireclral clr new tnrmiace ew retrmgemalr iew nl caler lank muge bckyrd Ready t innve n Over $40K al irgrante nn randal 8472199707 Retail abre tr nale Shre i 4935 q t Paikmrli area npnr 5000 Sib Ft dihilinal land niarghii be aailatnle tr develpment 1 cy vacate r el McDarriei Cirrehly irapa at upply Denmapher trathic cunt 21 000 car danlyl nthny R Davidn 8475683111 Fabulu 5000 ut cmmnhenrqm nr tanlalic lcahinll Bingluh liv ran penm t bange bruma Din rara Strnrng ilanad Rut w/decr cahmnmnet & tp et tn lune rapid cavled laina run w/mnamnry hve tireplace Manu hr bed w/tull bai Lwer Lev rec mn w/tplc Fil Kutctnen Barry Benvntte 6477081149 Grgeu 4 Bdrnma 35 till) Brick Luery lbnnme 25 car gar Gleanana g hndwd tr hhmrugtnl tainle teel appl niaple cab ralarble baill nnaher ue Huge backyard deck Full tiitned brnt wflarge tamily rm & tinll bahtn laundry rm $675000 Elena Dan 7732305985 Jhn Gua nwar Shah Khan S vana Mniacnn Grgeu 2 try lane 12 mm 5 bedrm 3 tuhl balla Entire tmu updated recently Large yard willi deck and 25 car garag Eucellent curb appeal $439900 Jhn Dia 8474092382 **PPHOED SHORT SLE** Feature 3 large ize bed 2 tll ball wihta eparate living rira dinning rna eat lii kn and tanll tirh baeraient willi a 4th tned/tlnce Mve lii cnditin $230000 Pirai Memn 8478636169 Clean well maintained biihding n Larg Lt whh 2 car cncrete blck garage it & 2nd Fr nnige 3 bedrm i batti uil have hdwd tr E/ Kltchieni ep Din Rm K newer ht wtr bnlerl itarmnt hlaw unit remdeled 2 bedrm 1 bat & newer OÍ turnac tiilding bia newer Rt 8 Windw tl Ethan Lewi 312307 0400 LNCOLNWOOD Thi czy nun tilled bllecc lia lt t tter Large eatinn kit tnihred lwer level w/tananily rm Gd hc laundry rann 3 bd im 2 tull bbn frmal dinning rna ll newer namecbnaical Large lenced yard There are al hardwd tlur unidr than carpet $329900 Chritina Ezz 7736167653 rame 2unit thnt n clean cndtin allhnugh tn h ighnet anad but ue tr thi prperty wuld prbably be a cnverir t a anew ing tarinily nme Zned RS3 Bth unit aie currently vacant but culd nc rented in al cnditin tr invetment incnnu $389000 Marku zadeh 7732304104 ntmny David David Rerun n ClretleUe Urlin Liz Llniay ley Miap Elena Dan nn Traedal Carece a t«ne Ceee Melanie Jane Jader Dminick CnSunta Dn Keenan Manc Shudniw Crinan Lewi Cl)